KEGG   Bacillus subtilis subsp. subtilis 168: BSU26160
Entry
BSU26160          CDS       T00010                                 

Symbol
yqbC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UTP15_C
Other DBs
NCBI-GeneID: 937712
NCBI-ProteinID: NP_390493
Pasteur: BG11274
BSORF: BG11274
UniProt: P45919 A0A6M4JLP4
Position
complement(2685162..2685815)
AA seq 217 aa
MNWMEFISSIVKSIIWPVAIIILVFKLKQPVSNLISTLAKIKYKDWEFEFTIDQKLDKIS
FQLNKENQYGTDDQNLKDSLNLESNSEITEETHSHYNEKTSIKGDNDLLLKMEMIRLYGA
VKNLYEKVSEKDDAADKSQGIGMLYMVDYLKRHKILNDSFAESLLDIMNIVHDLEKSHIS
QSYIMNKFFWNVDKSVKRLMEITSNYVAENTAGETSN
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaattggatggagtttatctcttcaatagtcaaatcaatcatttggccggtagcaata
attatcttggtttttaaattaaaacaaccggtttcaaatttgatcagtaccttggcgaaa
attaaatataaggattgggaatttgaattcactattgaccaaaaattagataagattagt
ttccaattgaataaagagaatcaatatggaactgatgatcaaaatctaaaagattcatta
aatttagaaagtaattctgaaatcactgaggaaacacattcccattataatgagaagaca
agcattaaaggggataatgacttactactaaaaatggaaatgattcgtttatatggagca
gtgaaaaatctttatgaaaaagtatcagaaaaagatgatgcggcagataaatctcaaggt
ataggcatgttatacatggttgattatttgaaacgccataaaattcttaatgattcattt
gcggaaagcttacttgatataatgaatatagttcatgacttagagaaaagtcatatttca
caaagctacattatgaataaatttttctggaatgtagataagagtgtaaaaaggttaatg
gagataacaagcaattatgttgctgagaatacagctggtgagacttctaattag

DBGET integrated database retrieval system