KEGG   Bacillus subtilis subsp. subtilis 168: BSU26170
Entry
BSU26170          CDS       T00010                                 

Symbol
yqbB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_Mu_F DUF1451
Other DBs
NCBI-GeneID: 937723
NCBI-ProteinID: NP_390494
Pasteur: BG11273
BSORF: BG11273
UniProt: P45918 A0A6M4JL47
Position
complement(2685856..2686773)
AA seq 305 aa
MNKTDKLLESLNVFIQKAEENQYKQLGEMVPDFPGKSNIPKYVEEYEKGIARLLRRQHKK
FLDGLKGFVSKDSEETLKALLVFFTQNLFAEDDFEEEFQELTEGFLQQTIEEMAEVIMDS
IDPEVPFKVLSNRTINWIKDWSKKLAEIMKLNTHEVVEDVLTNAIENGSSIQDIELTLKD
MPQFDRERARTTAITEVLAASSAAQHESYAQSPAVKKKKWRHSGGKKNNPRENHIDLDGT
VIGVDEEFQIPGSSETCMFPRDPKLSTRERVNCHCVLSPVVDSKILGLSPEEKEEIQREV
LANME
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaacaaaacggataagctattggagagtttaaatgtctttattcaaaaagccgaggaa
aatcagtataagcaattgggggagatggtacctgactttcctggcaaatctaatatcccc
aaatatgtggaggaatatgaaaaaggcattgccagattgctcagacgccagcataagaag
tttttagatggtctcaaaggttttgtaagcaaagactcagaagagacgttaaaagccctt
ctagtgttttttactcagaacctattcgcggaggatgacttcgaggaagaatttcaggaa
ctgactgagggattcctgcaacagactattgaagaaatggctgaagtaatcatggattca
atagatccagaggtgccttttaaagtcttatccaatcgtacgattaattggattaaggat
tggtcaaagaagctggctgagatcatgaagttaaacacacatgaagtggtggaggacgtg
ctaactaatgctatcgagaacggttcatcaatccaggacattgagttgactctcaaagac
atgccacaatttgatagggagcgggcgcgtaccacagccatcacagaagtgcttgccgct
tcctctgccgcgcagcatgaatcatatgcacaatcgccggcagtaaagaaaaagaaatgg
cggcacagcggagggaagaagaacaatcctcgtgaaaatcacattgatcttgacggtaca
gtcattggagtagatgaagaatttcagataccgggcagtagcgaaacctgcatgtttccg
agggatcctaaactatcaacaagggagcgggttaactgccattgtgttctatcgcctgtg
gtagatagtaagattttaggcttatcacccgaagaaaaagaagagattcaaagagaagtc
ttagcaaacatggaataa

DBGET integrated database retrieval system