KEGG   Bacillus subtilis subsp. subtilis 168: BSU26180
Entry
BSU26180          CDS       T00010                                 

Symbol
yqbA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_portal
Other DBs
NCBI-GeneID: 937707
NCBI-ProteinID: NP_390495
Pasteur: BG11272
BSORF: BG11272
UniProt: P45917 A0A6M4JML3
Position
complement(2686770..2688302)
AA seq 510 aa
MSKKSVKARVIKASPPTESTKQIYEDEFADSYDSNILPPPYNLKELKMIAEYSTILQQCV
DAYRTNIVGFGFDFEYSFDVNSPDVTNEEKTEAESEWTKLEEFVKYLHFDESAETLLGFV
IEDREKTGNGFIEVIRNGENKPAGIEYMDVQNVRVCKLSEPIEVDFTYFEQGQMKSIKRE
KRFRKYVQMIDGRMVYFKEYGDPRTLNLETGQYDEQTPLEKRANEVVHFKIGSGIYGKPR
WIGHIVNLYGARKAEELNFMYFKQGRHIPAAITIENGMLSEDSYTQLQDYMNGLEGVENA
HKFLLLEAEGIAKGKNIHGDEEIAPVKVDIKSLAEILQEDALFLEYDQKNRDKIRSAFRL
PPLYTGEAQDYNRATADTARKITEEQVFQPERKLITGKLNALFLNDLEIHKVRLQLKGPD
FRDPLEIAKVLTPFITAGAVSPNDLRDLAGRVLGKTLEEWPEEEYNRPLGKTNESSVSDP
LAALFKSKNGTPNMIGLLKDMRDVLEDLKR
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtcaaaaaaatctgttaaagcacgagtgatcaaagcctctccacctactgaatcaacg
aaacaaatttatgaagatgaatttgctgacagctatgacagcaatattttgcctcctccg
tataacctaaaggaattaaaaatgattgctgagtattcaacaatcttacagcaatgtgtt
gatgcctacaggacaaatattgtgggctttggatttgatttcgagtattcttttgatgtg
aattcgccagatgtgacaaatgaagaaaaaacagaagctgaaagtgaatggacaaagctt
gaagagttcgttaaatatcttcactttgatgagtcagctgagactttactcggatttgtt
attgaagatagagaaaagacgggcaatggctttattgaggtcattcgaaacggtgaaaat
aagccagccggcattgaatacatggacgttcaaaatgtacgagtttgcaaactgtctgaa
ccaatcgaagttgattttacgtacttcgaacaaggacaaatgaaatcaatcaaaagagag
aaacgattccgaaagtatgttcagatgattgacggccgtatggtttattttaaagaatat
ggtgatcctcgcactttaaatttagagacaggtcaatatgatgaacagaccccattggag
aaacgagcaaatgaagtggtccatttcaaaataggaagcggtatttatgggaaaccgcga
tggattggccatattgttaatttgtatggtgctcgtaaagctgaagagctgaactttatg
tacttcaaacaaggaagacatattcccgctgccatcacaatagaaaatggaatgttgtct
gaggactcatacacacaattgcaggattacatgaatgggcttgaaggagtggagaacgct
cataagtttctattacttgaagcagaagggatagcgaaggggaaaaacattcatggtgat
gaagagattgcaccagtgaaagttgatattaagtcacttgctgaaatccttcaagaagat
gctttgtttcttgaatatgaccaaaagaaccgagataaaattagatcggcttttcgtttg
cccccactttatacaggtgaagctcaagattacaacagagcgacagctgacacagcaaga
aagattactgaggaacaagtatttcagcctgaacgaaaattaatcacaggtaaactgaat
gctttatttctaaatgatcttgaaattcataaagtccgactccaactaaaagggccagac
tttagagatcctttagaaattgctaaggttctaacaccgtttataacagcaggtgcagtt
tctccgaatgatttacgcgatttggctggacgggtacttggtaagacgcttgaagaatgg
ccagaagaagaatacaacaggccgcttggtaaaactaacgagtcgtccgtttccgatcct
ttggctgcactgtttaaatctaagaacggtactcctaatatgatcgggttattaaaagat
atgcgggatgttctggaggatttgaagagatga

DBGET integrated database retrieval system