KEGG   Bacillus subtilis subsp. subtilis 168: BSU26190
Entry
BSU26190          CDS       T00010                                 
Symbol
yqaT
Name
(RefSeq) hypothetical protein
  KO
K06909  phage terminase large subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU26190 (yqaT)
SSDB
Motif
Pfam: Terminase_3 Terminase_3C Terminase_6N Monellin
Other DBs
NCBI-GeneID: 937721
NCBI-ProteinID: NP_390496
Pasteur: BG11271
BSORF: BG11271
UniProt: P45916 A0A6M3ZE99
Position
complement(2688306..2689601)
AA seq 431 aa
MIKQVNPHFKEFLFDWNQKFQFLVGGYGSSKSYHVALKIVLKLLREKRTALVIREVYDTH
RDSTFSLFDELVSDLKLDHIVRCVSSPMQIRFSNGSRIIFKGMDKPAKLKSINNISLIWI
EECSEVKYEGFKELLGRLRHPTLPLHMILSTNPVGEDNWTFKHFFKDDREKRFVLDDKEL
YEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYDPDLYRIARKGHFGVNGIRVLP
QFEERPHEEVMTAISNINRPLKRVGMDFGFVESYNAVVRVAVDHEKKYLYIYWEYYKNGL
TDDKTAEELKEFAETKELIKADSAEPKTIRYFQQHGFNMVGARKYQGSRLQYTKKIKRFR
KIICSDRCENTIYELKPLAYATDKLGNIIEDEFTIDPHTLSAIWYALDDYEVTDLKEESK
GRPQRSRPGRR
NT seq 1296 nt   +upstreamnt  +downstreamnt
gtgattaaacaggtaaatccacattttaaagaatttctctttgactggaatcaaaagttt
cagtttcttgtgggtggttatggatcatccaaaagctatcatgtggcgctcaagattgtt
ctgaaattgctcagagaaaagcgtactgcacttgttatcagagaagtgtacgacacacat
agggactcaacattttcactttttgatgaacttgtaagtgatctaaaattagatcatatc
gttagatgtgtatcttctccgatgcagattcgattttcaaatggcagcagaatcatcttt
aaagggatggataagccagccaaactgaaatcaatcaataatatttccctcatttggatt
gaggaatgctctgaagtaaaatatgaggggttcaaggagcttcttggacgtcttcgtcac
ccgacattgccgcttcacatgatactttcaacaaatccagttggagaggacaattggact
tttaagcatttcttcaaggatgatagggagaagcgctttgtactggatgataaggaactt
tatgaaaagcggataatcgttagcaacgacacctattatcatcactcaacggcagatgat
aatcttttcctgccagaaagctatgtccagcaacttgaagaattgaaggaatacgatcca
gacctttaccgaattgcgcggaaaggtcattttggcgtgaatggaattcgggttctgccg
cagtttgaagagcgaccgcatgaagaggttatgactgcaatctctaatattaaccgcccg
cttaaacgggttggcatggactttggttttgtggaatcgtataacgccgtcgttagggtt
gctgtggatcatgaaaagaaatatctctatatctactgggagtattacaaaaatggatta
acggatgataagacagccgaagaacttaaggaatttgcagagactaaggaattaatcaag
gcggattcagcagagccaaagacaatccgttattttcagcaacacggtttcaatatggtg
ggtgcccgtaaatatcaaggatcacgccttcagtatacaaagaaaatcaagcggttcagg
aagatcatttgctctgatcgttgcgagaacacgatttatgagcttaagccgcttgcttat
gctaccgataagctggggaacatcatagaagacgagttcaccatagacccgcatacactg
tcagctatctggtacgctctcgatgattatgaggtaaccgatttgaaagaagaatcaaaa
ggaagaccgcaaagatcaagaccaggaaggaggtaa

DBGET integrated database retrieval system