KEGG   Bacillus subtilis subsp. subtilis 168: BSU26210
Entry
BSU26210          CDS       T00010                                 

Symbol
yqaR
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HEPN_MAE_28990 HK_sensor Endonuc-BglII
Other DBs
NCBI-GeneID: 937703
NCBI-ProteinID: NP_390498
Pasteur: BG11269
BSORF: BG11269
UniProt: P45914 A0A6M4JNI4
Position
complement(2690381..2690845)
AA seq 154 aa
MIQIDFGTVITSAITAVFFTGGTNYVLQKKNRKGNEIFTKGYILIDEIYNINNKRIETAA
AFVPFYNHPEGYLEKLHTDYFKELSAFELIVKKFSILFDKELNIKLQEYINYLREVEVAL
RGFMNDDPIIEVNFNQEYIERLIDEITNLIKKHI
NT seq 465 nt   +upstreamnt  +downstreamnt
ttgattcaaatagattttggtacagtcattactagtgctataacagcagttttttttaca
ggtggaactaattatgttttacaaaagaagaatagaaaaggaaatgaaattttcacaaaa
ggctatatactaattgatgagatttataatattaacaataaaagaattgaaaccgctgct
gcctttgtaccgttctataatcacccagaaggatacttagaaaaattacatactgattat
tttaaagagctatcggcatttgaactgattgttaagaaattttcaatactctttgataaa
gaactgaatatcaagttacaggaatatataaattatttaagagaagttgaagtggcatta
agaggttttatgaacgatgatccaataattgaggtgaacttcaatcaagaatatattgag
cggttgattgatgaaataactaatttaataaaaaaacatatttaa

DBGET integrated database retrieval system