KEGG   Bacillus subtilis subsp. subtilis 168: BSU26220
Entry
BSU26220          CDS       T00010                                 

Symbol
yqaQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sigma70_r4 HTH_23 HTH_28 Sigma70_r4_2 HTH_38 GerE UL21a HTH_29
Other DBs
NCBI-GeneID: 937693
NCBI-ProteinID: NP_390499
Pasteur: BG11268
BSORF: BG11268
UniProt: P45948 A0A6M4JJH8
Position
complement(2690989..2691444)
AA seq 151 aa
MNRKEIENLINSYHWMVKEVRRLQRVLYGSVIPMKNWGVAQYGLEATMPKGSPGKSQAEL
RQMDMREERLFKRLKYYEERVYAVELGAEKIHGEQHKVIYDCMMEGMSYRAISLHLGISR
ETVRKMKDEFISQLCQDCHFERLLNLKKSVV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaatcgaaaagaaattgaaaatctaatcaatagctatcactggatggtgaaagaggtt
cgtcgattgcaaagggtactctatggttcagtaattcccatgaagaattggggtgttgct
caatatggattagaagctactatgccaaaaggaagtcctgggaagagtcaggctgagcta
aggcaaatggatatgagagaggaacgtcttttcaaacgtcttaagtattatgaagagcga
gtatatgcagttgaattaggggctgaaaagatccatggtgagcagcataaagtcatttat
gattgcatgatggagggtatgagctaccgcgcaataagtcttcaccttggcatttcaagg
gaaactgtacgcaaaatgaaagatgagttcatcagccaattatgccaagattgccacttt
gagcgtttgttgaatctgaaaaaatctgtagtgtaa

DBGET integrated database retrieval system