KEGG   Bacillus subtilis subsp. subtilis 168: BSU26230
Entry
BSU26230          CDS       T00010                                 

Symbol
yqaP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GatD_N
Other DBs
NCBI-GeneID: 937705
NCBI-ProteinID: NP_390500
Pasteur: BG11267
BSORF: BG11267
UniProt: P45913 A0A6M4JJY2
Position
2691642..2692571
AA seq 309 aa
MRVREIKNLLDNYNKQIGVSVSHVPHSNRKTVLNLQKSLDAINELSKLGFLDDDIERFKD
LGSIYYSRVPEDKIEVDNHIANQITNHIKIVKEKLRGFGILIDQSVSDQNENVISVKLPQ
YNSLEELEKFIKKLNNAFQNGITLEEINGHYKLQGFDTGSMWIDILVNSSAAVIFVGQLI
DAAINISKRSQELLITKANIEKLALQNEQLKLQVETSKALLDGIEKGIDTITDAEIKNVT
EGANYSTESIGHIKQSVKIFAELLHEGTQFHPSLDAPSETVEAFPEPQKNLEEPQQLLET
LADNLPEQE
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagagttagagaaataaaaaatttactcgacaattataataaacaaattggagttagt
gtttcgcacgtaccgcacagcaacagaaagactgttcttaatttacaaaagtctttagat
gcaattaacgagttgtctaaacttggttttttagatgatgatattgagagatttaaagat
ctaggaagtatatattattcacgtgtacctgaagataagattgaagtggataatcacatc
gctaatcaaattactaatcatataaaaattgtaaaagaaaaattacgtggttttggaatt
ttaattgatcagtcagtttctgatcaaaatgagaacgtaattagcgtaaaactccctcaa
tacaactcattagaagaactagaaaaattcatcaaaaaattaaataatgcatttcagaat
ggtattacccttgaggaaattaatggacattataaattacagggttttgacacaggttca
atgtggattgacatcttagtaaacagttcagctgcagtaatatttgttggacaacttata
gatgcagctataaacatttcaaagcgatctcaagaattactcattactaaggcaaacatc
gaaaagctagctcttcaaaatgagcaattaaagctacaagtcgaaacttccaaagctttg
ctagatggaattgaaaagggtattgacacaataacagatgccgaaataaaaaatgttact
gaaggagcaaattattcaacagaatcaataggacatataaaacaatcggttaaaatcttt
gcagaattactccatgaaggtacccaattccacccatctttagatgcaccttctgaaaca
gttgaagcctttcctgaaccccaaaagaatttagaagagcctcaacaattattagaaaca
ttagctgacaatttacctgaacaggaataa

DBGET integrated database retrieval system