KEGG   Bacillus subtilis subsp. subtilis 168: BSU26250
Entry
BSU26250          CDS       T00010                                 

Symbol
yqaN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RusA AAA_23
Other DBs
NCBI-GeneID: 937694
NCBI-ProteinID: NP_390502
Pasteur: BG11265
BSORF: BG11265
UniProt: P45911 A0A6M4JM30
Position
complement(2692933..2693361)
AA seq 142 aa
MDCIKFTVYGEPVAQGRPRGSIRNGKVHMRDPAKSKYFKQYVALVASQHRPETIITGPVS
MDVKVYRPMPKSVSNSKKKKEKAEKGLLRPTTKPDVDNYVKGVKDALNHLIYKDDSQVVD
LKVSKFYSEEPRVEVMIREVSA
NT seq 429 nt   +upstreamnt  +downstreamnt
ttggattgcattaagttcactgtttatggtgagccagtcgcacaaggaaggccgcgtgga
tcaatacgaaatgggaaggtgcatatgcgtgatccagcgaaatcaaagtatttcaaacag
tatgtggcattggttgcgtctcagcatcgaccagaaacaattattactggtcctgtctca
atggatgtcaaagtgtacagaccaatgcctaagtcagtttcaaactcaaaaaagaagaaa
gagaaagctgaaaagggccttctgcggccgactacaaagcccgacgttgataattatgta
aagggcgtgaaagatgctttgaatcatctgatatacaaagatgatagtcaggttgtggat
ttgaaagtcagtaagttttatagcgaagagccaagggtggaagtcatgataagagaggtt
tctgcctaa

DBGET integrated database retrieval system