KEGG   Bacillus subtilis subsp. subtilis 168: BSU26259
Entry
BSU26259          CDS       T00010                                 

Symbol
yqzO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 8302984
NCBI-ProteinID: YP_003097764
UniProt: C0H455 A0A6M4JLQ0
Position
complement(2693457..2693606)
AA seq 49 aa
MGMKKKTNIKATGGLYIFGPSNRNEGKDLTPTIRLLEEKIKQMERMLSA
NT seq 150 nt   +upstreamnt  +downstreamnt
ttgggaatgaaaaagaaaacgaatataaaagcaactggtggactttatatatttggccct
tcaaatcgaaatgaaggtaaagatcttacaccaacaatccgtttacttgaggaaaaaata
aagcaaatggagcggatgctgagtgcttaa

DBGET integrated database retrieval system