KEGG   Bacillus subtilis subsp. subtilis 168: BSU26260Help
Entry
BSU26260          CDS       T00010                                 

Gene name
yqaM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IstB_IS21 AAA_19 Bac_DnaA ATPase AAA_16 NACHT RuvB_N ATPase_2 AAA Viral_helicase1 Zeta_toxin AAA_22 DUF815 ABC_tran AAA_29 DUF87 KAP_NTPase AAA_30 AAA_24 ResIII AAA_14 AAA_17 RNA_helicase AAA_7 NB-ARC Pox_A32 FtsK_SpoIIIE AAA_18 AAA_5 Roc UvrD-helicase TsaE Torsin AAA_11 SMC_N Ploopntkinase3
Motif
Other DBs
NCBI-GeneID: 937685
NCBI-ProteinID: NP_390503
Pasteur: BG11264
BSORF: BG11264
UniProt: P45910
Position
complement(2693597..2694457)
Genome map
AA seq 286 aa AA seqDB search
MGTKQAVSEEKAEFDCPYCKDRGIVVYRVHKDTSWHLDEQLDLMVPDDMVSEDDFLLGKV
CTPDKASEWKDTYSKQCECVRRKKIARLMAASGITEEFEKLLFGNFITDGKPDMIKDAYE
CAVEYYKDFQKIKGERQNSIALLGQPGSGKTHLLTAIMNNLIKKKSVHCMYFPYVEGMGD
LKANFDNLEAKLDAMRKVEVLFIDDLFKPINGQPRATDWQVEQIQSVLNYRYLNHKPLLI
SSELTIDEILDIDEALGSRIHQMCRDYIVIIRGDRMQLNHRLGDWE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgggaacaaaacaggccgtatcagaagaaaaggctgaatttgattgtccttattgtaag
gatcgtggaattgtcgtttatcgagtccataaggacacttcttggcatttagatgaacag
ttagaccttatggttccggacgatatggtgtcggaagatgattttctgttaggtaaggtt
tgtacgccggataaagctagcgaatggaaagatacttattcaaaacagtgtgaatgtgta
agacgaaagaaaattgccagactcatggcagctagtggcattacagaagagtttgaaaag
cttctctttggtaacttcataacggacggtaagccagacatgatcaaggacgcttatgag
tgtgcagtggaatactataaagattttcaaaagatcaaaggagaaaggcaaaacagtatc
gcattacttggacagccaggtagcggtaaaactcatttgctcacggcgattatgaataat
ctgatcaagaaaaaatcagtacactgcatgtatttcccttatgtagagggcatgggtgat
ttgaaagctaactttgataacttagaagcaaaactcgatgccatgagaaaggtcgaagtt
ctattcattgatgatttatttaaaccaataaacggtcaaccaagggcaacagactggcag
gttgaacaaatccagtcagtcttgaactaccggtatttaaatcacaaacctttgctgatt
tcttcggagttaacaatcgatgagattttggatatagacgaggctcttggttcacgaatt
caccagatgtgccgtgattacatagtgattattagaggcgatcgaatgcaattaaatcat
aggttaggtgattgggaatga

DBGET integrated database retrieval system