KEGG   Bacillus subtilis subsp. subtilis 168: BSU26260
Entry
BSU26260          CDS       T00010                                 

Symbol
yqaM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA_19 IstB_IS21 Bac_DnaA ATPase AAA_16 NACHT RuvB_N ATPase_2 AAA Viral_helicase1 AAA_22 AAA_29 Zeta_toxin AAA_24 ABC_tran AAA_30 DUF87 DO-GTPase2 DUF815 KAP_NTPase AAA_14 ResIII AAA_17 RNA_helicase NB-ARC TsaE Pox_A32 FtsK_SpoIIIE AAA_5 UvrD-helicase Roc AAA_7 AAA_18 Torsin Ploopntkinase3 NTPase_1 SMC_N AAA_11 cobW
Other DBs
NCBI-GeneID: 937685
NCBI-ProteinID: NP_390503
Pasteur: BG11264
BSORF: BG11264
UniProt: P45910 A0A6M3ZE40
Position
complement(2693597..2694457)
AA seq 286 aa
MGTKQAVSEEKAEFDCPYCKDRGIVVYRVHKDTSWHLDEQLDLMVPDDMVSEDDFLLGKV
CTPDKASEWKDTYSKQCECVRRKKIARLMAASGITEEFEKLLFGNFITDGKPDMIKDAYE
CAVEYYKDFQKIKGERQNSIALLGQPGSGKTHLLTAIMNNLIKKKSVHCMYFPYVEGMGD
LKANFDNLEAKLDAMRKVEVLFIDDLFKPINGQPRATDWQVEQIQSVLNYRYLNHKPLLI
SSELTIDEILDIDEALGSRIHQMCRDYIVIIRGDRMQLNHRLGDWE
NT seq 861 nt   +upstreamnt  +downstreamnt
ttgggaacaaaacaggccgtatcagaagaaaaggctgaatttgattgtccttattgtaag
gatcgtggaattgtcgtttatcgagtccataaggacacttcttggcatttagatgaacag
ttagaccttatggttccggacgatatggtgtcggaagatgattttctgttaggtaaggtt
tgtacgccggataaagctagcgaatggaaagatacttattcaaaacagtgtgaatgtgta
agacgaaagaaaattgccagactcatggcagctagtggcattacagaagagtttgaaaag
cttctctttggtaacttcataacggacggtaagccagacatgatcaaggacgcttatgag
tgtgcagtggaatactataaagattttcaaaagatcaaaggagaaaggcaaaacagtatc
gcattacttggacagccaggtagcggtaaaactcatttgctcacggcgattatgaataat
ctgatcaagaaaaaatcagtacactgcatgtatttcccttatgtagagggcatgggtgat
ttgaaagctaactttgataacttagaagcaaaactcgatgccatgagaaaggtcgaagtt
ctattcattgatgatttatttaaaccaataaacggtcaaccaagggcaacagactggcag
gttgaacaaatccagtcagtcttgaactaccggtatttaaatcacaaacctttgctgatt
tcttcggagttaacaatcgatgagattttggatatagacgaggctcttggttcacgaatt
caccagatgtgccgtgattacatagtgattattagaggcgatcgaatgcaattaaatcat
aggttaggtgattgggaatga

DBGET integrated database retrieval system