KEGG   Bacillus subtilis subsp. subtilis 168: BSU26270
Entry
BSU26270          CDS       T00010                                 

Symbol
yqaL
Name
(RefSeq) DNA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DnaB_2 HTH_24 Fe_dep_repress UTP25 MarR_2 PaaX MarR NUMOD3
Other DBs
NCBI-GeneID: 937695
NCBI-ProteinID: NP_390504
Pasteur: BG11263
BSORF: BG11263
UniProt: P45909 A0A6M3ZIQ7
Position
complement(2694420..2695097)
AA seq 225 aa
MVIPRLPFKEFRDEKIYDHLFKRAEYRPNQELELGQTIIKVVELAKDFNWSAAQIKYSLD
RMEKQGYIKLHRLPQKRGLIVTILHYADYIQLGNYMKNKALEPAQIEHQEVDDKMKNAFE
LYENKVARSVGPMEAQRIGYMVDDYGEEKVMEAIKTAFQLKGKAASLSYVQAILSNPFTQ
KRKEKQYGYKQSSQYRHRISNDHAGTSGKVSPLFGNKTGRIRRKG
NT seq 678 nt   +upstreamnt  +downstreamnt
gtggtcataccccgactaccattcaaagagtttagggatgaaaaaatttatgatcacttg
ttcaaaagagctgaatacaggccaaatcaagagctagaacttgggcagaccattatcaaa
gttgtggaactagcaaaagattttaactggtcagctgcacagatcaaatactcactagac
cgaatggagaaacagggatatatcaaattgcaccgtcttccacaaaaaagagggctcatc
gtcaccatacttcattatgcagactacatacaactaggaaattacatgaagaacaaagct
ttggaaccagctcagattgaacatcaggaggtcgatgacaaaatgaaaaatgcctttgag
ctatatgaaaacaaagttgctcggtcagtcggcccgatggaggcacagcggatcggctac
atggtcgacgattatggtgaggaaaaagtgatggaggctatcaagacagcgtttcaatta
aaggggaaagctgcaagtttgtcatatgttcaagccatcttatcaaatccattcactcaa
aagagaaaggagaaacaatatggctataaacaaagcagtcagtatagacaccgcatttca
aacgatcatgcaggaacttcgggaaaggtcagcccgctttttgggaacaaaacaggccgt
atcagaagaaaaggctga

DBGET integrated database retrieval system