KEGG   Bacillus subtilis subsp. subtilis 168: BSU26280
Entry
BSU26280          CDS       T00010                                 

Symbol
yqaK
Name
(RefSeq) hypothetical protein
  KO
K07455  recombination protein RecT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU26280 (yqaK)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSU26280 (yqaK)
SSDB
Motif
Pfam: RecT DUF4172
Other DBs
NCBI-GeneID: 937691
NCBI-ProteinID: NP_390505
Pasteur: BG11262
BSORF: BG11262
UniProt: P45908 A0A6M4JML9
Position
complement(2695173..2696027)
AA seq 284 aa
MATNQSIKNNIQKKQKNVPVQQQGATMKGLLSSPSVIKRFEEVLGKRATQFTASILSLYN
SEQMLQKTDPMSVISSAMVAATLDLPIDKNLGYAWIVPYGGKAQFQLGYKGYIQLALRTG
QYKSINCIPIHEGELQKWNPLTEEIEIDFEKRESDAVIGYAAYFELINGFRKTVYWTKAQ
VEKHKKKFSKSDFGWKNDWDAMALKTVLKAVLSKWGILSVEMQKAVIEEDETRERIDITN
EADSSEIIDSEPSNKDETEKPSAQETDPFDGKPVDIKDDELPFD
NT seq 855 nt   +upstreamnt  +downstreamnt
atggctactaatcaatcaattaaaaacaacatccaaaagaaacaaaaaaacgtacctgtg
caacaacaaggagcaacaatgaaagggctactttcctcaccatctgttattaaacgattt
gaggaagtgttagggaagagggctacacagtttactgcttctatcttaagcctttataac
agcgagcagatgctacagaaaacagatcctatgagcgtcatatcctcagcaatggtggca
gctacactcgatttacctatagataaaaacttagggtatgcctggattgttccttacgga
ggtaaggctcaatttcagcttggatacaaaggatatatccagctagccttacgaacaggc
caatataaatccatcaattgcataccgattcatgaaggcgaattgcagaagtggaatccg
ttgactgaggagatcgagattgattttgaaaaacgagaatcagacgcggtaattggttat
gcagcttattttgagttgataaatggcttccgaaaaacagtgtactggacaaaggcacaa
gtagagaagcacaaaaagaaattcagtaagtctgattttggatggaaaaatgactgggat
gcgatggctcttaagactgtattaaaagcagttttgagcaagtgggggattctctctgtt
gaaatgcaaaaagcagttattgaggaagatgaaacaagggaacggattgacattaccaat
gaggcagacagttcagaaattatcgattccgagccttcaaacaaagatgaaacggaaaaa
ccaagcgcccaagaaaccgatccttttgacggcaagcctgtagatataaaagacgatgaa
cttccgtttgattga

DBGET integrated database retrieval system