KEGG   Bacillus subtilis subsp. subtilis 168: BSU26290
Entry
BSU26290          CDS       T00010                                 
Symbol
yqaJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqaJ
Other DBs
NCBI-GeneID: 937681
NCBI-ProteinID: NP_390506
Pasteur: BG11261
BSORF: BG11261
UniProt: P45907 A0A6M3ZEB0
Position
complement(2696030..2696989)
AA seq 319 aa
MTSKRAEVLAKNSEMSRDEWLIERRKGIGGSDASIILGLNKWKTPFELWLDKTGQVPVSE
SQSEAAYFGSLLEDIVAKEFEIRSGKKVRRKKAILRHPEYNFILANVDRMIVGEKAILEC
KTTSAYNLKEWEDEEIPESYIVQVQHYLGVLGPEYRKAYFAVLIGGNKFVWKEIERDDEL
IDMIFKAEIEFWNDKVLGGQAPALDGSSAAEEYLKKRYAETENNKAIDLTAANRERIQQY
LLIKEQISELQSQAKELENQIKHEMKDAEYGFIGNYQACWKPVVSNRIDTKKLKDQFPDV
YEKVKKETHFRRFGIKEVS
NT seq 960 nt   +upstreamnt  +downstreamnt
atgacaagcaaacgggctgaggttcttgctaagaattctgaaatgagccgtgatgaatgg
cttattgaaagaagaaaaggaattggcggctcagatgcatccattatcttggggctgaac
aagtggaagacaccttttgaattatggttagacaaaacaggacaggtccctgttagtgaa
tcgcaaagtgaagctgcttactttggatcattgctagaagatattgttgcaaaagaattt
gagatacgtagtggcaagaaggttagacgtaaaaaagcaatactcagacatccagaatat
aatttcattttggctaatgttgatcgaatgatcgttggtgaaaaagcgatccttgaatgt
aaaacaacatcagcctacaacttaaaagaatgggaggacgaagaaatccccgagagctat
atcgttcaggtccagcattatctgggtgtgcttggacctgaatatcggaaagcttatttt
gctgtgctgattggcgggaacaaatttgtctggaaagagattgagcgagacgacgagtta
attgacatgatctttaaagcagagattgagttctggaatgacaaggtcttaggtggacaa
gctcctgctttagatggttcaagtgctgcggaggaatacctcaaaaaacgatatgccgaa
acggaaaataacaaagctattgatttaactgcggctaatcgagaacgtattcaacaatac
ttgcttattaaagaacagatctcagagcttcaaagccaggcaaaagaattagagaaccaa
atcaaacatgaaatgaaggatgcagagtatgggtttatcggtaactatcaagcttgctgg
aagcctgttgtctcaaatcgaattgacacgaaaaagctcaaagaccagtttccggatgta
tacgagaaagttaaaaaggaaactcatttcagacgttttggaatcaaggaggttagctga

DBGET integrated database retrieval system