KEGG   Bacillus subtilis subsp. subtilis 168: BSU26300
Entry
BSU26300          CDS       T00010                                 

Symbol
yqaI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Yqai
Other DBs
NCBI-GeneID: 937680
NCBI-ProteinID: NP_390507
Pasteur: BG11260
BSORF: BG11260
UniProt: P45906 A0A6M4JNR9
Structure
Position
complement(2697095..2697289)
AA seq 64 aa
MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEF
KNAQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atggtcgaaaatccaatggtcataaacaactggcacgataagctgactgaaacggatgta
caaatagatttttacggtgatgaagtaacaccagttgatgattatgtaattgatggcggc
gaaatcattctcagagagaacttggaaaggtatctaagggagcaacttggttttgaattt
aaaaacgcgcaataa

DBGET integrated database retrieval system