KEGG   Bacillus subtilis subsp. subtilis 168: BSU26300Help
Entry
BSU26300          CDS       T00010                                 

Gene name
yqaI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Yqai RE_AspBHI_N
Motif
Other DBs
NCBI-GeneID: 937680
NCBI-ProteinID: NP_390507
Pasteur: BG11260
BSORF: BG11260
UniProt: P45906
Structure
PDB: 

Position
complement(2697095..2697289)
Genome map
AA seq 64 aa AA seqDB search
MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEF
KNAQ
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaatccaatggtcataaacaactggcacgataagctgactgaaacggatgta
caaatagatttttacggtgatgaagtaacaccagttgatgattatgtaattgatggcggc
gaaatcattctcagagagaacttggaaaggtatctaagggagcaacttggttttgaattt
aaaaacgcgcaataa

DBGET integrated database retrieval system