KEGG   Bacillus subtilis subsp. subtilis 168: BSU26310
Entry
BSU26310          CDS       T00010                                 

Symbol
yqaH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqaH Cep57_CLD_2
Other DBs
NCBI-GeneID: 937692
NCBI-ProteinID: NP_390508
Pasteur: BG11259
BSORF: BG11259
UniProt: P45905 A0A6M4JJI7
Position
complement(2697419..2697676)
AA seq 85 aa
MNTNHFLKADVPIAKRKIESAEELSIMLSEALRDGDYEEAISLAGSIKVLTEDISRLANK
GRLYETALKMQQQGINLTVVSRCIG
NT seq 258 nt   +upstreamnt  +downstreamnt
atgaatactaatcatttcttgaaggcagatgttcctatcgcaaaaagaaaaatcgaatca
gcagaagagctatcaatcatgctgtcagaggcattacgtgatggtgattatgaagaagcg
attagtcttgctggaagcatcaaggttcttactgaggatattagccggcttgcaaacaaa
ggacgcctttatgaaacggcattgaaaatgcaacagcaaggtatcaacttaactgtagtg
agcaggtgtataggatga

DBGET integrated database retrieval system