KEGG   Bacillus subtilis subsp. subtilis 168: BSU26350
Entry
BSU26350          CDS       T00010                                 

Symbol
yqaE
Name
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_37 HTH_26 Phage_CI_repr MqsA_antitoxin DnaI_N
Other DBs
NCBI-GeneID: 937672
NCBI-ProteinID: NP_390512
Pasteur: BG11256
BSORF: BG11256
UniProt: P45902 A0A6M3ZIQ0
Position
2698893..2699243
AA seq 116 aa
MFSENLKKCRKQKKLTQQNMADKLGITRPAYTAYELGSREPDYKTLINISNILDVSLDYL
LKGESNEKVFQDEAKKVLNDPETFLAAKDGEVTDEILQAALEIITEQLKERRKSDK
NT seq 351 nt   +upstreamnt  +downstreamnt
atgttctccgagaacttgaaaaagtgcagaaaacaaaagaaactaacccaacaaaatatg
gctgataaacttggaattactcggcctgcctacaccgcctatgaactaggtagtcgtgag
cctgactataaaaccttaattaatatttcaaacatacttgatgtttctttggattatctt
cttaaaggagaaagcaatgaaaaagtatttcaggatgaagcaaaaaaagtgttaaacgat
cctgaaacattccttgcagcaaaagacggtgaggtaacagatgagatcttacaggctgct
ttggagattataacggagcaattaaaagaaagacggaaatcagataaataa

DBGET integrated database retrieval system