KEGG   Bacillus subtilis subsp. subtilis 168: BSU26370
Entry
BSU26370          CDS       T00010                                 

Symbol
yqaC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA_18 PRK AAA_33 SKI AAA_28 ABC_tran
Other DBs
NCBI-GeneID: 937669
NCBI-ProteinID: NP_390514
Pasteur: BG11254
BSORF: BG11254
UniProt: P45900 A0A6M3ZE52
Position
complement(2700033..2700569)
AA seq 178 aa
MKKNIHILGASGVGTSTLGAALSKRLPHTHLDTDNYYWLDKFTKKREIPERRKLLEKDLT
INEKWILSGAVCGWGDNLKSYFDLVVFLWIPQDIRLERLRHREFQRYGNEVLAGGSKYEQ
SKTFLEWASLYDNAGMEVRSRALHEHWMADLSCPVLKIEDDCSVNERVDRVLDYLSSN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatattcacatattgggagcctctggtgtcggaacttcaacattgggtgct
gcattatcaaagcgtttgcctcatacgcatcttgatactgataattactattggttagac
aaattcactaaaaaaagagaaattcctgaaagaagaaagttgcttgaaaaagacttaaca
atcaatgaaaaatggattctttctggtgcagtgtgtggctggggcgataatctaaaaagt
tattttgaccttgtcgtcttcttatggattccacaagatatacggcttgagagactaagg
cacagggaatttcagcgttatggaaacgaagtgttagccggtggcagtaaatatgaacaa
tcaaaaacatttttagagtgggcttctttatatgataatgctggaatggaagttagaagt
agagctttgcatgaacattggatggcagatttatcttgtccagtgttaaagattgaagac
gactgctcagtcaatgaaagagttgaccgtgtcttggattatctgagttctaattaa

DBGET integrated database retrieval system