KEGG   Bacillus subtilis subsp. subtilis 168: BSU26370Help
Entry
BSU26370          CDS       T00010                                 

Gene name
yqaC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 PRK AAA_33 SKI AAA_28 ABC_tran
Motif
Other DBs
NCBI-GeneID: 937669
NCBI-ProteinID: NP_390514
Pasteur: BG11254
BSORF: BG11254
UniProt: P45900
Position
complement(2700033..2700569)
Genome map
AA seq 178 aa AA seqDB search
MKKNIHILGASGVGTSTLGAALSKRLPHTHLDTDNYYWLDKFTKKREIPERRKLLEKDLT
INEKWILSGAVCGWGDNLKSYFDLVVFLWIPQDIRLERLRHREFQRYGNEVLAGGSKYEQ
SKTFLEWASLYDNAGMEVRSRALHEHWMADLSCPVLKIEDDCSVNERVDRVLDYLSSN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatattcacatattgggagcctctggtgtcggaacttcaacattgggtgct
gcattatcaaagcgtttgcctcatacgcatcttgatactgataattactattggttagac
aaattcactaaaaaaagagaaattcctgaaagaagaaagttgcttgaaaaagacttaaca
atcaatgaaaaatggattctttctggtgcagtgtgtggctggggcgataatctaaaaagt
tattttgaccttgtcgtcttcttatggattccacaagatatacggcttgagagactaagg
cacagggaatttcagcgttatggaaacgaagtgttagccggtggcagtaaatatgaacaa
tcaaaaacatttttagagtgggcttctttatatgataatgctggaatggaagttagaagt
agagctttgcatgaacattggatggcagatttatcttgtccagtgttaaagattgaagac
gactgctcagtcaatgaaagagttgaccgtgtcttggattatctgagttctaattaa

DBGET integrated database retrieval system