KEGG   Bacillus subtilis subsp. subtilis 168: BSU26380
Entry
BSU26380          CDS       T00010                                 

Symbol
yqaB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M78 DUF4202
Other DBs
NCBI-GeneID: 937668
NCBI-ProteinID: NP_390515
Pasteur: BG11253
BSORF: BG11253
UniProt: P45899 A0A6M3ZE54
Position
2700838..2701356
AA seq 172 aa
MRYTNSHLEDWIENLYKKIDITEPEQINFERIAEALDIRLSFKPVTSFALKHSGIYNICL
DSRKSRTEQWYDFAHEFCHIYRHEGDKKTMPATWTDYLDWQSNYFTYHFCIPTCMLRNIN
LPYIQSHAIENVAWLFKVSPSFAKKRLSIYYRKLTQHLFSQTVTGNLCPPFL
NT seq 519 nt   +upstreamnt  +downstreamnt
ttgaggtatacaaacagtcatttagaggattggattgaaaacttatacaagaagattgat
attacagaaccagaacaaattaattttgaacggattgccgaggctttagatatcaggctt
tcgtttaaacctgttacaagcttcgcacttaaacacagcggaatttataatatatgcttg
gacagccgtaaaagccgaactgaacaatggtatgattttgctcatgaattttgccatata
tatagacatgaaggcgataaaaaaacaatgcctgcaacttggactgattatttggattgg
cagtccaattattttacatatcacttttgcattccaacttgcatgttgcgtaatatcaac
cttccgtacatacaatcacatgcaattgaaaatgtagcttggttatttaaggtatcccct
tcattcgctaagaaacgtttaagcatttattacaggaaactgactcaacatttatttagt
caaactgttacgggaaatttatgccccccctttttgtaa

DBGET integrated database retrieval system