KEGG   Bacillus subtilis subsp. subtilis 168: BSU26400
Entry
BSU26400          CDS       T00010                                 

Symbol
yrkS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937670
NCBI-ProteinID: NP_390517
Pasteur: BG11785
BSORF: BG11785
UniProt: P54446 A0A6M3ZHJ7
Position
complement(2701979..2702143)
AA seq 54 aa
MKVIIIEGLQTDKCMNDCYHYLIKLYRQEIQGDSNISWNKRSRDRASTARSRPV
NT seq 165 nt   +upstreamnt  +downstreamnt
atgaaggtaataatcatcgagggactgcaaactgacaaatgcatgaacgattgctatcat
tatttaataaaactttataggcaggagatccagggtgatagcaatatatcgtggaacaag
cgatcaagggatcgagcatcgacagccagatcgaggcctgtataa

DBGET integrated database retrieval system