KEGG   Bacillus subtilis subsp. subtilis 168: BSU26410
Entry
BSU26410          CDS       T00010                                 

Symbol
yrkR
Name
(RefSeq) phosphate-starvation-inducible protein PsiE
  KO
K13256  protein PsiE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU26410 (yrkR)
SSDB
Motif
Pfam: PsiE TgpA_N
Other DBs
NCBI-GeneID: 937665
NCBI-ProteinID: NP_390518
Pasteur: BG11784
BSORF: BG11784
UniProt: P54445 A0A6M3ZKY6
Position
complement(2702688..2703104)
AA seq 138 aa
MRFSNKFKKVPYLLQALLNVCLFFLALALSALLISETWYIVLFVYKSLFNKVDSYYEMLG
ELLIFFMYFEFIALIIKYFKSDFHFPLRYFIYIGITAVIRLIIIDHDQAISTFWWAMAIL
AMICGFFIANRRNSVVEH
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagattttctaacaaattcaaaaaggtgccttacctgttacaagcgcttctcaacgtc
tgtctgttctttctggcgttagccttaagcgcacttctgatcagcgagacttggtacatt
gtgctattcgtatacaagtcactgttcaacaaagtggacagctattatgagatgcttgga
gaactgcttatattcttcatgtactttgagttcattgctttgattatcaaatacttcaaa
tcagactttcattttccgcttcgctacttcatttatattggcatcacagctgtcattcgt
ttgattatcatcgatcatgatcaggcgatctcaacgttctggtgggcgatggccattctt
gcaatgatttgtggattctttattgccaatagacgaaattctgttgttgaacattaa

DBGET integrated database retrieval system