KEGG   Bacillus subtilis subsp. subtilis 168: BSU26420Help
Entry
BSU26420          CDS       T00010                                 

Gene name
yrkQ
Definition
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA HAMP HATPase_c_5 PXA HATPase_c
Motif
Other DBs
NCBI-GeneID: 937662
NCBI-ProteinID: NP_390519
Pasteur: BG11783
BSORF: BG11783
UniProt: P54444
Position
complement(2703150..2704448)
Genome map
AA seq 432 aa AA seqDB search
MAHLKFTLTKKLALLIMVAAIVSGVIFLTLQKITDDLIEGYLSSEEYYHEESARYIQKFS
KYVSENELSTSDRKAFGEWVKKENYINLTIFKDQELQYDSIYSESDYGKEKLTQYAQNHS
HPVKFSDGEGRVIIDGFYSSRYYDLAFALDLLGATLIFLIIVLFGIRQSLRYLKTIHQEI
HILEGGELDYEMTIKGHDELAMIAKSIEDLRKAFLDKLKAIEELQAESRSLVTEMSHDMR
TPLTSLIMNLEFAKKEGGEAGASKDRYVANAYGKALQLKSLSDNLFAYFLLNKEYEADLE
TVAVKEVIYDLISDQIAILHQEHFRVHISGELPETYINVNLEELGRVFDNVMSNLLKYAD
PEEKISITFVSDQEIFEIHVSNTIKLADITPESNGLGERSIARMMSRMQGQFHSIQKNSK
YYIVLRFWNTKM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcatcttaaatttacgctaaccaaaaaactggctttgctgataatggttgctgcg
attgtgagtggtgtgatctttctgacgttgcaaaagatcacagatgatctgatcgaggga
tatctgagttcggaagagtattatcacgaggagtcagcaagatacattcaaaaattcagc
aagtacgtttcagaaaatgagttgtctacatcagatagaaaagcgtttggcgagtgggtc
aaaaaagaaaattacattaacctcaccatattcaaggatcaggagctgcaatatgattct
atttattccgaatcggattatggaaaggaaaagctgactcagtacgctcaaaatcattca
catcctgtcaagtttagcgatggtgaaggacgagtcattatcgacggtttctactcttcc
cgatattatgatctggcctttgcattggatttgctcggggcaaccctcatctttttaatc
attgttctcttcggaattcgccaaagtcttcgctaccttaaaacgattcatcaagagatt
catattcttgaagggggcgaactggactacgagatgacgataaaagggcatgatgaatta
gcgatgattgcaaagagcattgaggatctgcggaaagctttcctggataaacttaaagct
atcgaggaattgcaagctgagagccgcagcctggttaccgaaatgtcgcacgatatgcgc
acaccgctgacgtcgctgatcatgaatctggagtttgccaaaaaagagggaggcgaagcg
ggtgccagcaaagatcggtatgtagccaatgcttatggtaaagcactgcaattaaaaagc
ttgtctgacaatctgtttgcgtatttcctgctgaacaaggaatatgaggccgatctggag
accgttgcagtgaaagaagtgatctacgatctaatatcagatcagattgctatccttcat
caggagcattttcgggtccatatttcaggcgagctgccggaaacctatattaacgtgaat
ttggaggagcttggtcgtgtatttgataatgtgatgtcaaacttattgaaatacgcagat
ccggaagaaaaaatcagtatcacgtttgtatcggatcaagagatatttgagatccatgtt
agcaatacgattaaacttgcagatataacaccggaaagcaacggactcggtgaaagaagc
attgcgcgaatgatgtcccgcatgcagggacagtttcacagtatacaaaagaattctaag
tactacattgtgctacgattttggaacaccaagatgtag

DBGET integrated database retrieval system