KEGG   Bacillus subtilis subsp. subtilis 168: BSU26440
Entry
BSU26440          CDS       T00010                                 

Symbol
yrkO
Name
(RefSeq) hypothetical protein
  KO
K07148  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU26440 (yrkO)
SSDB
Motif
Pfam: DUF418
Other DBs
NCBI-GeneID: 937667
NCBI-ProteinID: NP_390521
Pasteur: BG11781
BSORF: BG11781
UniProt: P54442 A0A6M4JM42
Position
2705398..2706615
AA seq 405 aa
MIVQKEGRGQPVSLRERVHFLDIVRGFALLGIIIVNYFLIVDSVKGFEMASDDVLHKLVS
WFAEGKFVTLFSFLFGVGFMIFMDRAAQKVESPNKLFARRLSILLGFGILHITFVWVGDI
LAFYAVSGFLLLAFYKRTAKTVLRWIIALIVFQFLTPVFTMLYNVINTAGSKNPNFSEFT
LFSHSSLTYMESISTRWTDMVTMAAGSFSMIYSMFLMFLLGVYFVKMEFFKDMEAKKPIW
KRIWIISTIAFLITQSSILLDMFNLSENMLWKDISSVLGQNGGLTGSMFYMSTFAMLFLY
LPQLRGPMMIFTKVGRMSLTCYLLHSIIGTVLFLRYGFGLADHIQSAGTFMFSLAVYFVL
MSFSTLWLKRFRYGPMELVWRKLTYGKVNGSPKATPLHSEKSIQK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgattgtacaaaaagaaggacgcgggcaaccggtgagtctgcgggaacgggttcatttt
ctggacatcgtacgaggatttgccttgcttggcattattattgtcaattattttctgatc
gtagattcagtaaagggattcgaaatggcctccgatgacgtactgcataagctggtttcc
tggtttgccgaagggaaattcgttacgttattctccttcctgttcggagtcgggtttatg
atctttatggatcgagccgcgcagaaggtagagagtcccaacaagctgtttgcccgcagg
ttatctatcctgttgggatttggcattttgcacatcacatttgtttgggtcggtgacata
ttggccttttacgccgtaagtggcttcctgttactcgccttctataaacgcacggccaaa
acggtgcttagatggattatcgcacttatcgtgtttcaattcctgactcctgttttcaca
atgttgtacaatgtcatcaatactgcagggtcaaaaaacccgaatttttcagagtttact
ttgtttagccacagcagccttacctacatggaatccatcagcactcggtggacagatatg
gtcacgatggctgccggctctttctctatgatctattccatgtttctcatgtttctgctg
ggcgtgtactttgttaagatggaatttttcaaagacatggaagcgaaaaagcctatatgg
aagcgtatctggatcattagcacaatcgcttttctaataacacaaagcagtatattacta
gacatgtttaatctttctgagaatatgctgtggaaggacatttcctctgtcttgggtcaa
aatggcggcttaaccggaagtatgttttatatgagcacttttgcaatgctgtttctatac
cttcctcagctgcgaggccctatgatgatattcaccaaagtcggacggatgtcattgacc
tgttatctgcttcactctatcattggaacagttctgttcctcaggtacggattcgggctt
gcggatcatattcaatccgccggcacgttcatgttcagtctggccgtgtacttcgttctt
atgagctttagtacattgtggttgaaacggtttaggtacggtccgatggaattagtatgg
cgcaagctgacgtacggcaaagtaaacgggagtcccaaagcaactccgctgcattcggaa
aaatctattcagaaataa

DBGET integrated database retrieval system