KEGG   Bacillus subtilis subsp. subtilis 168: BSU26450
Entry
BSU26450          CDS       T00010                                 

Symbol
yrkN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 NAT
Other DBs
NCBI-GeneID: 937664
NCBI-ProteinID: NP_390522
Pasteur: BG11780
BSORF: BG11780
UniProt: P54441 A0A6M4JL75
Position
2707127..2707684
AA seq 185 aa
MKTKNEPKVILELAKESDLPEFQKKLQEAFAIAVIETFGDCEDGPIPSDNDVQESFNAPG
AVVYHILQDGKNVGGAVVRINSQTNHNSLDLFYVSPEYHSQGIGLSAWKAIEAQYPDTVL
WETVTPYFEKRNINFYVNKCGFHIVEFYNEHHSNPHMHRNGREDDKPLLNDDDFFRFVKI
MKKKD
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaaaactaaaaatgaaccaaaagttattctggaactagcaaaggaatctgatctgcca
gaattccaaaaaaaattacaagaagcctttgcgatcgccgtgattgaaacgttcggtgat
tgcgaagatgggccgattccatcggacaatgatgttcaggagtctttcaatgctcccgga
gcagtggtatatcatattcttcaggatggtaagaatgtcggtggtgcagtagtacgtatc
aacagccaaacaaatcataattcgctagatttattctatgtatctccagaatatcacagc
caagggattggtctttctgcttggaaagccattgaagcacagtatccggatactgtgctt
tgggaaaccgtgacaccttatttcgaaaagcgaaatatcaacttctatgtgaataagtgt
ggatttcatatcgtagagttctacaatgaacatcactctaatccgcatatgcatcgcaat
ggacgtgaagatgacaagcccctactgaatgatgatgactttttcagatttgtaaagatt
atgaaaaaaaaggactaa

DBGET integrated database retrieval system