KEGG   Bacillus subtilis subsp. subtilis 168: BSU26470
Entry
BSU26470          CDS       T00010                                 

Symbol
yrkL
Name
(RefSeq) NAD(P)H oxidoreductase YrkL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Flavodoxin_2 FMN_red
Other DBs
NCBI-GeneID: 937658
NCBI-ProteinID: NP_390524
Pasteur: BG11778
BSORF: BG11778
UniProt: P54439 A0A6M3ZEN6
Position
complement(2708175..2708699)
AA seq 174 aa
MKTLVIVIHPNLETSVVNKTWMNRLKQEKDITVHDLYGEYPNFIIDVEKEQQLLLDHERI
VFQFPMYWYSSPALLKQWEDDVLTHGWAYGTGGTKLHGKELLLAISLGAQESDYQAGGEY
NITISELIRPFQVTANYIGMRFLPAFTQYGTLHLSKEDVKNSAERLVDYLKAEH
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaaaacattagttatcgttatacatcctaatttggaaacgtctgttgtcaacaaaacc
tggatgaatcgtttaaagcaagagaaagacattacggttcatgacctgtacggtgaatac
cctaattttatcattgatgtagaaaaagagcagcagctcctgttagatcatgagcgtatc
gtttttcagttcccaatgtattggtacagcagtcccgcgttactcaaacaatgggaagat
gatgtgttaacacatggctgggcttatggaactggaggaactaaattgcatggaaaagaa
ctactcttagctatctccttaggcgcacaggaatctgattatcaagcaggcggagaatat
aatatcacgatcagcgagcttatcagaccgtttcaagtcactgctaactatataggaatg
cgttttcttcctgcgtttacacaatatgggacacttcatctttcaaaagaagatgttaag
aacagtgcggagagattggttgactatcttaaagccgagcattaa

DBGET integrated database retrieval system