KEGG   Bacillus subtilis subsp. subtilis 168: BSU26470Help
Entry
BSU26470          CDS       T00010                                 

Gene name
yrkL
Definition
(RefSeq) NAD(P)H oxidoreductase YrkL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-GeneID: 937658
NCBI-ProteinID: NP_390524
Pasteur: BG11778
BSORF: BG11778
UniProt: P54439
Position
complement(2708175..2708699)
Genome map
AA seq 174 aa AA seqDB search
MKTLVIVIHPNLETSVVNKTWMNRLKQEKDITVHDLYGEYPNFIIDVEKEQQLLLDHERI
VFQFPMYWYSSPALLKQWEDDVLTHGWAYGTGGTKLHGKELLLAISLGAQESDYQAGGEY
NITISELIRPFQVTANYIGMRFLPAFTQYGTLHLSKEDVKNSAERLVDYLKAEH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattagttatcgttatacatcctaatttggaaacgtctgttgtcaacaaaacc
tggatgaatcgtttaaagcaagagaaagacattacggttcatgacctgtacggtgaatac
cctaattttatcattgatgtagaaaaagagcagcagctcctgttagatcatgagcgtatc
gtttttcagttcccaatgtattggtacagcagtcccgcgttactcaaacaatgggaagat
gatgtgttaacacatggctgggcttatggaactggaggaactaaattgcatggaaaagaa
ctactcttagctatctccttaggcgcacaggaatctgattatcaagcaggcggagaatat
aatatcacgatcagcgagcttatcagaccgtttcaagtcactgctaactatataggaatg
cgttttcttcctgcgtttacacaatatgggacacttcatctttcaaaagaagatgttaag
aacagtgcggagagattggttgactatcttaaagccgagcattaa

DBGET integrated database retrieval system