KEGG   Bacillus subtilis subsp. subtilis 168: BSU26480
Entry
BSU26480          CDS       T00010                                 

Symbol
yrkK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HXXEE
Other DBs
NCBI-GeneID: 937659
NCBI-ProteinID: NP_390525
Pasteur: BG11777
BSORF: BG11777
UniProt: P54438 A0A6M3ZE64
Position
complement(2708943..2709419)
AA seq 158 aa
MVYFVAFFCFAITLHNIEEAIWLPEWSQQSSKFQKPVTSNEFHFAVIVITMLAYLSAFGF
LYMPESDIAKWIFIGFLGSMVINAIFPHLIATVVMKKYAPGLLTGLLLNIPVNSLVIYQM
FLKNLIVWKELIISTLVVGIILLALIPLLFKVGDKVSP
NT seq 477 nt   +upstreamnt  +downstreamnt
gtggtttatttcgtagcatttttttgttttgctattacacttcataatattgaggaagct
atttggttacctgagtggtcacaacaatcttcaaagtttcaaaagccagtaacttcaaat
gaatttcattttgctgtcattgttataactatgttggcttatttatctgcatttggtttt
ttatatatgccagaatcagatattgcaaaatggattttcattggctttctaggttctatg
gttatcaacgctatttttccacatcttatcgcaactgttgtaatgaaaaagtatgcacct
ggacttcttacgggcttattgcttaacattccagtaaactcattagttatttatcaaatg
tttttaaagaatttgattgtatggaaggagttaataatatctacgttggttgtaggaatt
attttattagcacttattccattattatttaaagttggtgataaagtatctccttaa

DBGET integrated database retrieval system