KEGG   Bacillus subtilis subsp. subtilis 168: BSU26480Help
Entry
BSU26480          CDS       T00010                                 

Gene name
yrkK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HXXEE
Motif
Other DBs
NCBI-GeneID: 937659
NCBI-ProteinID: NP_390525
Pasteur: BG11777
BSORF: BG11777
UniProt: P54438
Position
complement(2708943..2709419)
Genome map
AA seq 158 aa AA seqDB search
MVYFVAFFCFAITLHNIEEAIWLPEWSQQSSKFQKPVTSNEFHFAVIVITMLAYLSAFGF
LYMPESDIAKWIFIGFLGSMVINAIFPHLIATVVMKKYAPGLLTGLLLNIPVNSLVIYQM
FLKNLIVWKELIISTLVVGIILLALIPLLFKVGDKVSP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtggtttatttcgtagcatttttttgttttgctattacacttcataatattgaggaagct
atttggttacctgagtggtcacaacaatcttcaaagtttcaaaagccagtaacttcaaat
gaatttcattttgctgtcattgttataactatgttggcttatttatctgcatttggtttt
ttatatatgccagaatcagatattgcaaaatggattttcattggctttctaggttctatg
gttatcaacgctatttttccacatcttatcgcaactgttgtaatgaaaaagtatgcacct
ggacttcttacgggcttattgcttaacattccagtaaactcattagttatttatcaaatg
tttttaaagaatttgattgtatggaaggagttaataatatctacgttggttgtaggaatt
attttattagcacttattccattattatttaaagttggtgataaagtatctccttaa

DBGET integrated database retrieval system