KEGG   Bacillus subtilis subsp. subtilis 168: BSU26490Help
Entry
BSU26490          CDS       T00010                                 

Gene name
yrkJ
Definition
(RefSeq) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU26490 (yrkJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-GeneID: 937654
NCBI-ProteinID: NP_390526
Pasteur: BG11776
BSORF: BG11776
UniProt: P54437
Position
complement(2710002..2710787)
Genome map
AA seq 261 aa AA seqDB search
MDIAFITTLFIIGFIGAFISGMIGIGGAVINYPMLLYIPSLVGVMSLTAHEVSGIGAIQV
FFATLGGVWAYRKSGLINKTLIIYMGSSILLGSVLGSYFSHYISEKGINFIYGILAIIAV
ILMFIPKKGQKGQEHSEDKEVIFNKWLASSLAFIIGGVSGILGAGGAFILVPIMLSILNI
PVRVTVASSLAITFLSSIGATVGKVITGQVLFVPALVLMITSLIASPIGASVGQKVNTKF
LQWVLAQLIGATAIKIWLELL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcctttatcacaactcttttcattatagggtttattggtgcctttatttcc
ggaatgattggtattggcggagcagttattaattatccaatgctattgtacattccttct
ttagtgggagtgatgtcattaactgcccatgaagtttcagggataggggctattcaagtt
ttttttgcgacactcggcggtgtttgggcttatcgtaagagtggtcttataaataaaaca
ttaattatttacatgggaagcagcatccttttagggagtgtattggggagttacttttct
cattatatatctgaaaaaggaattaactttatatacggaattctggctattatagcagtt
attttaatgtttatacctaaaaaaggacagaaaggacaagaacatagcgaagataaggaa
gtgatatttaataaatggttggcttcttccttagcgtttatcattggtggcgtatcaggt
attttaggagctggcggcgcctttatcctagtccccattatgttatcgattttaaatatt
cctgttagagtcacagtcgcttcatctcttgcgattacatttctttcatccattggcgca
acagttggaaaagtaatcacgggccaggttctttttgtaccagctctggttcttatgatt
actagtttaatagcttctcctattggcgcatcagttgggcaaaaagtaaatacaaaattc
ctgcaatgggttttagcgcaattaataggtgcgacagctattaaaatttggttagagctc
ctttga

DBGET integrated database retrieval system