KEGG   Bacillus subtilis subsp. subtilis 168: BSU26500Help
Entry
BSU26500          CDS       T00010                                 

Gene name
yrkI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TusA DUF2249 DUF3148
Motif
Other DBs
NCBI-GeneID: 937657
NCBI-ProteinID: NP_390527
Pasteur: BG11775
BSORF: BG11775
UniProt: P54436
Position
complement(2710848..2711075)
Genome map
AA seq 75 aa AA seqDB search
MKSDKVLDAKGLACPMPIVRTKKAMNELESGQILEVHATDKGAKNDLTAWSKSGGHDLLE
QTDEGDILKFWIQKG
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagataaagtattagacgcaaaaggcttggcatgcccaatgccaattgtcaga
acaaaaaaagcgatgaatgaactggaatcaggtcaaatattagaagtgcatgcaacagat
aagggagccaaaaatgatcttacagcctggtctaaatcaggcggacatgaccttttagag
caaacggacgagggcgatatattgaaattttggattcaaaaaggctaa

DBGET integrated database retrieval system