KEGG   Bacillus subtilis subsp. subtilis 168: BSU26510
Entry
BSU26510          CDS       T00010                                 

Symbol
yrkH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B Rhodanese Lactamase_B_2
Other DBs
NCBI-GeneID: 937656
NCBI-ProteinID: NP_390528
Pasteur: BG11774
BSORF: BG11774
UniProt: P54435 A0A6M4JJK2
Position
complement(2711109..2712242)
AA seq 377 aa
MKHDRKGNDPKRSDKKIFNKEPLFILDVRNENDFSDWKIEGHDFDHLNVPYFDLLDGVED
ILEKIPSDKEVLVVCAKEGSSVMVSEMLSEAGHSVSYLKGGMKAWSEHLEPVKVGDLKDG
GEMYQFVRIGKGCLSYMVISNGEAAIIDATRMVNFFIDFAKGKGATITHVFDTHLHADHI
SGGRVIAEKTKATYWLPPKDAEEVEFDYQPLEEGNDIIIGNTTIKIQPIYSPGHTIGSTS
FIVDDQYLLSGDILFIDSIGRPDLAGMAEDWVGDLRKTLYSRYKALSKDLIVLPAHFMII
DELNENGSVGKQLSTLFSENHGLNIADETEFRHLVTDHLPPQPNAYQEIRETNMGKISPD
EEKQREMEIGPNRCAIR
NT seq 1134 nt   +upstreamnt  +downstreamnt
ttgaaacatgaccgtaaaggcaatgaccccaaaagaagtgacaaaaaaatctttaacaaa
gaacctttatttattttggatgtgcgtaatgaaaatgattttagtgattggaagatagaa
gggcatgactttgaccatttgaatgttccttattttgatcttttagatggcgtagaagat
atcttggagaaaattccttctgataaagaagtgctggtcgtttgcgcaaaagaaggttca
tccgtcatggtatccgaaatgctttctgaagcaggtcattctgtatcctaccttaagggt
ggaatgaaagcatggagcgaacatttagagccggtaaaagtcggggatttaaaagatggc
ggtgagatgtatcagtttgttcgaatcggtaaaggctgcttgtcatacatggtcatttcc
aatggtgaagcagcaattattgatgcgacacgtatggtgaatttctttatagattttgcg
aaggggaagggtgcaacgattactcacgtatttgatacacatcttcacgcggaccatatt
tcaggcggcagagtcattgctgaaaaaacaaaagcaacctactggttaccgcctaaagat
gctgaagaagtggaattcgattatcagccgttggaagaaggaaatgacattattattgga
aatacaacgattaaaattcaaccgatttattctccggggcacacgattggctccacttct
ttcattgtcgatgaccagtatcttctttcaggtgatatcttgtttattgattcaatcggc
agaccagacttagccggtatggcagaagattgggtaggagatttaagaaaaacgctttat
agccgttacaaagcgttatcaaaggatttaattgtattaccggcacactttatgatcatt
gacgagctaaatgagaatggaagtgttggtaaacaactaagtacattatttagcgagaac
catggtttgaacattgcggatgaaacagaatttagacacctagtaacagatcatttgcct
ccgcaaccaaatgcataccaagagattcgagaaacaaacatggggaaaatcagcccagat
gaagaaaaacagcgtgaaatggagattggcccaaaccgctgtgcaatacggtaa

DBGET integrated database retrieval system