KEGG   Bacillus subtilis subsp. subtilis 168: BSU26530Help
Entry
BSU26530          CDS       T00010                                 

Gene name
yrkF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TusA Rhodanese DUF2249 DUF3880
Motif
Other DBs
NCBI-GeneID: 937647
NCBI-ProteinID: NP_390530
Pasteur: BG11772
BSORF: BG11772
UniProt: P54433
Position
complement(2712577..2713134)
Genome map
AA seq 185 aa AA seqDB search
MMKATIVLDAKGLACPMPIVKTKKRMKDLKAGEVLEIHATDKGSTADLEAWAKSTGHEYL
GTEAEGEILRHFLRKGGEHSSENASSIPEISLEAFKQKVDSDESLNILDVREIEEYEKAH
IPGVVHIPLGEVEKRANELNENDEIYIICHSGRRSEMAARTMKKQGFKKVINVVPGMRDW
TGKTE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcaactattgtactagacgctaaaggtttggcgtgtccaatgcctatcgta
aaaacgaagaagagaatgaaggatttaaaagctggtgaagtattggaaattcatgcgaca
gataaaggttctacagcagatctggaagcatgggcaaaaagtacaggccatgaatatctg
ggtactgaagcagagggagaaatacttcgtcattttcttcgaaaaggaggagagcattca
tcagaaaatgcatcttcaattcctgagatttcattagaagctttcaaacagaaagtagat
agtgacgagtctcttaacattttagatgttcgagagatagaggaatatgaaaaagctcat
atcccaggagttgtgcatatccctcttggtgaagtggaaaagcgcgctaacgaattaaac
gaaaatgatgaaatttatattatctgccattcgggaagaaggagtgaaatggcggcccgc
accatgaaaaaacaaggttttaaaaaggttattaatgttgtcccgggtatgcgggattgg
acaggtaaaaccgaataa

DBGET integrated database retrieval system