KEGG   Bacillus subtilis subsp. subtilis 168: BSU26540
Entry
BSU26540          CDS       T00010                                 

Symbol
yrkE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DrsE_2 DrsE Pox_P35
Other DBs
NCBI-GeneID: 937651
NCBI-ProteinID: NP_390531
Pasteur: BG11771
BSORF: BG11771
UniProt: P54432 A0A6M4JLG1
Position
complement(2713320..2713802)
AA seq 160 aa
MTEQTKRTTIVLFSGDYDKAMAAYIIANGAAAYDHEVTIFHTFWGFNALRKEELIPVKKG
FLEKMFGKMMPRGADKMGLSKMNFAGMGPKMIKNVMKKHNVLTLPQLIEMAQEQGVKLVA
CTMTMDLLGLQEKELLDDIDYAGVAAYLADAEEGSVNLFI
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacagaacaaacaaaacgcacaacaattgttttatttagcggggattatgataaagca
atggcagcctatattattgcaaatggtgcagctgcctacgatcatgaagtgacgatcttc
catactttttggggatttaacgctttacgtaaagaagagctgattccagtgaaaaaagga
tttcttgaaaaaatgtttggaaagatgatgcctcgtggtgctgataagatgggtttatct
aaaatgaactttgcaggtatgggccctaaaatgattaaaaatgtgatgaaaaagcataat
gtacttactttacctcagttgattgagatggctcaagaacagggggtaaagctcgtagct
tgtacgatgacaatggatcttcttggtttacaggaaaaagaactattagatgatattgac
tatgctggtgtagcagcttatttggcagatgctgaggaaggcagtgtcaacttatttatc
taa

DBGET integrated database retrieval system