KEGG   Bacillus subtilis subsp. subtilis 168: BSU26540Help
Entry
BSU26540          CDS       T00010                                 

Gene name
yrkE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DrsE_2 DrsE Rho_N Pox_P35
Motif
Other DBs
NCBI-GeneID: 937651
NCBI-ProteinID: NP_390531
Pasteur: BG11771
BSORF: BG11771
UniProt: P54432
Position
complement(2713320..2713802)
Genome map
AA seq 160 aa AA seqDB search
MTEQTKRTTIVLFSGDYDKAMAAYIIANGAAAYDHEVTIFHTFWGFNALRKEELIPVKKG
FLEKMFGKMMPRGADKMGLSKMNFAGMGPKMIKNVMKKHNVLTLPQLIEMAQEQGVKLVA
CTMTMDLLGLQEKELLDDIDYAGVAAYLADAEEGSVNLFI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaaacaaaacgcacaacaattgttttatttagcggggattatgataaagca
atggcagcctatattattgcaaatggtgcagctgcctacgatcatgaagtgacgatcttc
catactttttggggatttaacgctttacgtaaagaagagctgattccagtgaaaaaagga
tttcttgaaaaaatgtttggaaagatgatgcctcgtggtgctgataagatgggtttatct
aaaatgaactttgcaggtatgggccctaaaatgattaaaaatgtgatgaaaaagcataat
gtacttactttacctcagttgattgagatggctcaagaacagggggtaaagctcgtagct
tgtacgatgacaatggatcttcttggtttacaggaaaaagaactattagatgatattgac
tatgctggtgtagcagcttatttggcagatgctgaggaaggcagtgtcaacttatttatc
taa

DBGET integrated database retrieval system