KEGG   Bacillus subtilis subsp. subtilis 168: BSU26560
Entry
BSU26560          CDS       T00010                                 

Symbol
yrkC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cupin_2 Cupin_1 MannoseP_isomer
Other DBs
NCBI-GeneID: 937645
NCBI-ProteinID: NP_390533
Pasteur: BG11769
BSORF: BG11769
UniProt: P54430 A0A6M4JLR9
Position
complement(2714933..2715493)
AA seq 186 aa
MYYNPFSPQCYYYVTVPMYNDGRSVYWTIPNEMEKVHRGADLRSSYEDRNLLLKDYGPKP
FVVNINRATKQNNTFRTALWTGKHFQVTLMSLGIGEDIGLEIHPNVDQFLRIEQGRGIVK
MGKSKDHLNFQRNVYDDSAIVVPAGTWHNVINTGNTPLKLYSIYAPPNHPFGTVHETKAD
AVAAED
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtactataaccctttttcgcctcaatgttattattatgtgactgtgccgatgtataat
gatggaagatctgtttattggactattccaaatgagatggagaaagtacacagaggtgcc
gatttgcgctcttcatatgaagatagaaaccttcttttgaaggattatggaccaaaacca
tttgttgtaaatatcaatagagccacaaaacaaaacaatacgttccgtactgctttatgg
acaggaaagcattttcaagttactttgatgagtcttggtattggagaagacattggtttg
gaaatccatcctaacgttgaccagttcttacggattgagcaggggcgtgggatcgtcaaa
atgggaaagagcaaagatcatttgaactttcaaagaaatgtctatgatgattctgccatt
gttgtccctgccggcacttggcacaacgtaattaatacaggaaatacgccattaaaactt
tactccatttatgctcctcctaaccatccatttggtacagttcatgaaaccaaagcagat
gcagtggctgcggaagattag

DBGET integrated database retrieval system