KEGG   Bacillus subtilis subsp. subtilis 168: BSU26570
Entry
BSU26570          CDS       T00010                                 

Symbol
yrkB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937648
NCBI-ProteinID: NP_390534
Pasteur: BG11768
BSORF: BG11768
UniProt: P54429 A0A6M3ZEK3
Position
complement(2715719..2715865)
AA seq 48 aa
MLLKNWPSRRIQRDKSKRAGIGGTNNRIPYTLLLCYVNVQKPFRIVDL
NT seq 147 nt   +upstreamnt  +downstreamnt
atgctgctgaaaaactggccatcaaggcgcatccaaagagataaatctaaaagagctggg
ataggggggacaaacaacagaattccgtatactctgttgttgtgctatgtaaatgttcaa
aagccatttaggatcgtcgacctttga

DBGET integrated database retrieval system