KEGG   Bacillus subtilis subsp. subtilis 168: BSU26580Help
Entry
BSU26580          CDS       T00010                                 

Gene name
bltR
Definition
(RefSeq) multidrug-efflux transporter 2 regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR MerR-DNA-bind Exotox-A_bind
Motif
Other DBs
NCBI-GeneID: 937644
NCBI-ProteinID: NP_390535
Pasteur: BG10904
BSORF: BG10904
UniProt: P39842
Position
complement(2716035..2716856)
Genome map
AA seq 273 aa AA seqDB search
MSEDVKKYFTTGEFSKLCRVKKQTLFHYDEIGLFSPEIKKENGYRYYSYHQFETFQVISL
FKELGVPLKEIKCLIKGKTPDKILHVLKEKSIEIDKKINELKQLQTILQTKVTLTEQALE
TDFSSISFEYLNEETFMLSRKTLNLPERKYVAAISELIHEVQQYELDEGYPIGGIFAREQ
ILEKDFYNYSYFYIKVKDGAENINYHVRPKGLYAVGYEIGGNTEEAYRRIIEFIERNGMQ
IGENAYEEYMLDEMVVDGYENTYAKILLQVKEV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagatgttaagaagtatttcacaacaggggagttttcgaagctctgccgtgta
aaaaaacaaactttatttcattatgatgagattggtcttttctcgccggaaataaaaaaa
gaaaatgggtatagatattattcctatcatcaatttgagacttttcaagtcatcagtcta
tttaaagagcttggggttccattaaaagaaataaagtgtctaataaaaggaaaaacacca
gacaagatcctgcatgttctaaaagaaaagtctattgagattgataaaaaaataaatgag
cttaagcagttgcaaacgatcttacaaacaaaagtgacgcttacagaacaagcacttgag
actgatttttcctcaatttcttttgaatatttaaatgaagaaacattcatgttaagccga
aaaacattaaacttaccagaacgaaaatatgtggcagccatttcagaactcattcatgaa
gttcagcaatatgaattagatgaaggatatccgataggcggaatctttgcacgggaacaa
atcttagaaaaagacttctacaattacagttacttttatataaaagtaaaagatggggca
gagaacataaattatcatgtacggccaaaaggcctgtatgcagttggatatgaaataggc
ggaaatactgaagaggcgtaccggagaatcattgagttcattgaaagaaatggaatgcaa
ataggggaaaatgcatatgaggaatatatgctggatgagatggtagttgacgggtatgaa
aatacatatgcaaaaatcctccttcaagttaaagaggtgtaa

DBGET integrated database retrieval system