KEGG   Bacillus subtilis subsp. subtilis 168: BSU26590Help
Entry
BSU26590          CDS       T00010                                 

Gene name
blt
Definition
(RefSeq) multidrug resistance protein 2
  KO
K08153  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU26590 (blt)
Transporters [BR:bsu02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BSU26590 (blt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 Sugar_tr MFS_1_like MFS_3 OATP MFS_4 UNC-93 UPF0182 Gaa1
Motif
Other DBs
NCBI-GeneID: 937646
NCBI-ProteinID: NP_390536
Pasteur: BG10905
BSORF: BG10905
UniProt: P39843
Position
2716973..2718175
Genome map
AA seq 400 aa AA seqDB search
MKKSINEQKTIFIILLSNIFVAFLGIGLIIPVMPSFMKIMHLSGSTMGYLVAAFAISQLI
TSPFAGRWVDRFGRKKMIILGLLIFSLSELIFGLGTHVSIFYFSRILGGVSAAFIMPAVT
AYVADITTLKERSKAMGYVSAAISTGFIIGPGAGGFIAGFGIRMPFFFASAIALIAAVTS
VFILKESLSIEERHQLSSHTKESNFIKDLKRSIHPVYFIAFIIVFVMAFGLSAYETVFSL
FSDHKFGFTPKDIAAIITISSIVAVVIQVLLFGKLVNKLGEKRMIQLCLITGAILAFVST
VMSGFLTVLLVTCFIFLAFDLLRPALTAHLSNMAGNQQGFVAGMNSTYTSLGNIFGPALG
GILFDLNIHYPFLFAGFVMIVGLGLTMVWKEKKNDAAALN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaataaatgagcaaaaaacgatattcattatactattaagcaacatcttc
gtagcatttcttggtatcggtttaatcattccagttatgccttcttttatgaaaatcatg
catttatccggcagcacaatgggttatcttgttgcggcttttgccatttctcagttaatt
acttcaccttttgcaggtaggtgggttgaccgtttcgggagaaaaaaaatgattattctc
gggttgcttatattcagtttatctgagttgattttcggattagggacccatgtttcaata
ttttatttctcgaggatattgggtggtgtaagtgcggcttttatcatgcccgcggtaaca
gcatatgtagctgatattacaaccctaaaggaaaggtcaaaggctatggggtatgtttct
gctgcaattagcaccggctttattattggacctggtgcgggaggatttattgccggcttt
ggtatccgcatgccgtttttcttcgcctccgccatcgcgttaatagcagctgtcacttcc
gtttttatactaaaagagtcattgtcgatagaagaacgccatcaactctcatctcataca
aaggaatcaaatttcattaaagacttgaagagatccattcatcctgtctatttcattgca
tttattatcgtctttgtaatggcttttggtttatcagcttatgaaacggtattcagcttg
ttttctgatcataaatttggcttcacaccaaaagatattgcagccattattacgattagt
tccattgttgcggtagttattcaagttttactattcgggaaattggtcaacaaacttgga
gagaaaagaatgattcagctgtgcttaataaccggtgcgatcttggctttcgtgtctact
gttatgtcaggatttttaactgttttgcttgtaacttgttttatttttctggcgttcgat
ttgctacgtccggccttaaccgctcatttatccaatatggccggtaaccagcagggtttc
gtagcaggcatgaactccacatacaccagcctgggaaatatatttggacctgctctaggc
ggtatactatttgatcttaacattcattatcctttcctttttgcaggtttcgttatgatt
gtcggccttggtcttacaatggtttggaaagaaaaaaagaatgatgctgcagctttgaat
taa

DBGET integrated database retrieval system