KEGG   Bacillus subtilis subsp. subtilis 168: BSU26600
Entry
BSU26600          CDS       T00010                                 

Symbol
bltD
Name
(RefSeq) spermine/spermidine acetyltransferase
  KO
K00657  diamine N-acetyltransferase [EC:2.3.1.57]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU26600 (bltD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     BSU26600 (bltD)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4 FR47 Acetyltransf_3 Acetyltransf_8 Acetyltransf_CG Acetyltransf_15 Acetyltransf_18
Other DBs
NCBI-GeneID: 937632
NCBI-ProteinID: NP_390537
Pasteur: BG10906
BSORF: BG10906
UniProt: P39909 A0A6M4JNS4
Position
2718344..2718802
AA seq 152 aa
MSINIKAVTDDNRAAILDLHVSQNQLSYIESTKVCLEDAKECHYYKPVGLYYEGDLVGFA
MYGLFPEYDEDNKNGRVWLDRFFIDERYQGKGLGKKMLKALIQHLAELYKCKRIYLSIFE
NNIHAIRLYQRFGFQFNGELDFNGEKVMVKEL
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagtataaacataaaagcagtaactgatgataatcgtgctgcaattcttgatctacat
gtcagccagaatcaattatcatatattgaatctacaaaagtatgtttagaagatgcaaaa
gaatgtcactattataaacctgtcgggctttactatgaaggagatctagtcggttttgca
atgtatggattgtttcccgagtatgatgaagataataaaaacggacgagtctggcttgac
cgattttttattgacgaacgctatcagggaaaaggattagggaagaaaatgcttaaagcc
ctcattcagcaccttgctgagttatataaatgcaagagaatttatttaagtatatttgaa
aataatattcatgctatacgcctttatcaaaggtttggttttcaatttaatggtgaactc
gactttaatggtgagaaggtaatggtaaaagagctatag

DBGET integrated database retrieval system