KEGG   Bacillus subtilis subsp. subtilis 168: BSU26610
Entry
BSU26610          CDS       T00010                                 

Symbol
yrkA
Name
(RefSeq) hypothetical protein
  KO
K03699  magnesium and cobalt exporter, CNNM family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU26610 (yrkA)
   02042 Bacterial toxins [BR:bsu02042]
    BSU26610 (yrkA)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU26610 (yrkA)
Bacterial toxins [BR:bsu02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   BSU26610 (yrkA)
SSDB
Motif
Pfam: CNNM CorC_HlyC CBS
Other DBs
NCBI-GeneID: 937634
NCBI-ProteinID: NP_390538
Pasteur: BG11767
BSORF: BG11767
UniProt: P54428 A0A6M3ZEE4
Position
complement(2718959..2720263)
AA seq 434 aa
MTTINLIIFTLLIVLTAFFVATEFAIVKIRSSKIDQLILEGKKGAISAKKVITHLDEYLS
ACQLGITVTALGIGWVGESTFEVILHPLFAHFHVSETVSHVLILVIAFVMATFLHVVVGE
LAPKTLAIQKAETITLLTAKPIIWFYRILFPFIWFLNGSARFIVGLFGLKPASEHELAHS
EEELRILLSESYKSGEINQNELKYVNNIFEFDERIAKEIMIPRREIVAISSEDSYETIVK
IIKTESYTRYPVLNGDKDSIIGFINAKEFLSAYIDTDQKIKEDFKLENHINPVIHVIESV
PIHDVLVKMQKERTHIAILVDEYGGTSGLVTAEDILEEIVGEIRDEFDKDEVPNIRKVND
NHYILDSKVLIEDVNDLLGTTLASDEVDTIGGWFMTQQIDAAVGSVIEADGYIFKVHETV
GRHINYLEIVRKKE
NT seq 1305 nt   +upstreamnt  +downstreamnt
ttgacaaccattaaccttataatctttactcttttaattgtcttaacagcattttttgtt
gcgactgaatttgcgatagtaaagatcaggtcatcaaaaattgaccaactcatattagag
ggaaaaaaaggtgccatatcagccaaaaaggtcattactcatttggacgaatatttgtca
gcttgtcaattagggatcacggttacagcgttgggaattggctgggtcggagaatcgact
tttgaagtgattttgcaccccttatttgctcattttcatgtaagtgaaacagtctcacat
gtattgatcttagtgattgcttttgtgatggcgacttttttgcacgttgtagttggagag
cttgctcctaaaacactcgctatccaaaaagcggaaaccatcactcttttgactgcaaag
ccaattatttggttttaccgcatcctgttcccttttatatggtttttaaatggttcagcc
cggtttatagtaggactcttcggtttgaaacctgcatcagaacatgaacttgctcattct
gaagaagaactgcgcatcttactgtctgaaagctataagagcggtgaaatcaatcaaaat
gagttgaaatatgtaaataatatttttgaatttgatgaaagaatcgccaaagaaattatg
attccgagaagagagatcgtagcgatttctagtgaggattcttatgaaactattgttaag
atcattaagacagagagctatacaaggtacccagtcctaaatggagataaagattcaatc
attggttttatcaatgctaaagaatttttgtcagcttatattgacacagaccagaagata
aaagaggatttcaagttagaaaatcatatcaaccctgttatccatgttattgaatccgtt
ccaattcatgatgtattggtaaaaatgcaaaaagagcgaacacatatcgctattcttgtg
gatgaatatggcggcacttcaggtttagtcactgctgaagatattcttgaagaaattgtc
ggggaaatcagagatgaatttgataaagatgaagtgcctaatattagaaaagtaaatgat
aatcactatatcttagattcgaaagtgctcattgaagatgtaaatgatttattgggaacg
acgttagcaagtgacgaagtggatacaataggcggctggtttatgactcaacaaatagac
gctgcagttgggtccgttatagaagccgatgggtatatttttaaagtgcacgaaacagtt
ggccggcatattaattatttagaaattgtccggaaaaaagaataa

DBGET integrated database retrieval system