KEGG   Bacillus subtilis subsp. subtilis 168: BSU26619
Entry
BSU26619          CDS       T00010                                 

Symbol
yrzO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YrzO
Other DBs
NCBI-GeneID: 8303041
NCBI-ProteinID: YP_003097765
UniProt: C0H458 A0A6M4JJL1
Position
complement(2720526..2720669)
AA seq 47 aa
MFEGLLFFISAGIVCELAAINRNGRKNIKQQAELIQILKENLYKDIK
NT seq 144 nt   +upstreamnt  +downstreamnt
atgtttgaaggtttattgtttttcatttcagctggaattgtctgtgaacttgctgcaatt
aatagaaatggccgcaaaaatataaagcaacaggccgaattgattcaaattttaaaagaa
aatctttataaagacattaaataa

DBGET integrated database retrieval system