KEGG   Bacillus subtilis subsp. subtilis 168: BSU26620
Entry
BSU26620          CDS       T00010                                 

Symbol
yrdR
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA Phage_holin_2_4 DUF2418
Other DBs
NCBI-GeneID: 937629
NCBI-ProteinID: NP_390539
Pasteur: BG12289
BSORF: BG12289
UniProt: O07086 A0A6M4JK80
Position
complement(2720687..2721652)
AA seq 321 aa
MKKGQLFIGALTCLVASMSWGAMFPVADHALEFVDPFYFSFIRYGVVTIMLVILLLVREG
KKSFHLEGKAKWIILFGVMAFTIYNVLIFLGQRLMGKSGIMTASIAEALMPMLSIVILWG
YKHVKPKKYTMISILIAFLGASMVITKGNISFFFSLGDHLFSILFIFIGVLGWVVYTMGG
QIFREWSTLRYSTLTCLFGTAITGIMTAILTAQGYVSVPSIKVIAAIKYDFLFMITLPGI
IALLSWNYGIKILSSINGILFINFVPITTLLIMVIKGYNITAFDIVGTLFVIIGLILNNI
YQRKEDYKQVLQKEKTNLTIT
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaaaaaaggtcaattattcattggtgcccttacatgtttagtagcaagtatgtcttgg
ggcgcgatgtttccagttgcagatcatgcattagaatttgttgatccgttttatttttca
tttattcgctacggtgtggtaacgattatgttagtgattttattattggtgagagaagga
aagaaatcatttcatttagagggtaaagcaaaatggatcattttatttggggtgatggcg
tttactatatacaatgttcttatttttttaggtcaaaggttgatggggaagtctggaatt
atgacagcatccattgccgaggcactcatgccgatgctttcaattgttattctatgggga
tataaacatgtgaaacctaaaaaatacacaatgatcagtatattgattgcctttttgggg
gcttcgatggtcataaccaaaggtaatataagtttctttttttcattaggggatcatcta
ttctcgatactctttatattcattggtgttttagggtgggttgtctacacaatgggggga
cagatattccgagagtggtccacacttcgttattcaactttgacatgtttattcggcaca
gctataacaggaatcatgacagctatacttaccgcgcaaggttacgtgtcggtaccgagt
attaaagtgattgcagcaattaagtatgattttttatttatgattactttaccaggtatc
atagccctccttagttggaactatggcattaaaatcctatcatccattaatgggatttta
tttattaactttgtccccattactacattgttaatcatggtgatcaaaggatataacata
actgcttttgatatagtaggaacactgtttgtcattattggactcattttaaataacata
tatcagcgtaaggaagattataagcaggtattgcaaaaagaaaaaacaaatttgactatc
acttag

DBGET integrated database retrieval system