KEGG   Bacillus subtilis subsp. subtilis 168: BSU26630Help
Entry
BSU26630          CDS       T00010                                 

Gene name
yrdQ
Definition
(RefSeq) LysR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 Vps51 NMT1_2
Motif
Other DBs
NCBI-GeneID: 937628
NCBI-ProteinID: NP_390540
Pasteur: BG12288
BSORF: BG12288
UniProt: P71025
Position
2721778..2722644
Genome map
AA seq 288 aa AA seqDB search
MELRDLQIFKCVAHHKSITGAAKELNYVQSNVTARIKQLENELKTPLFNRHKKGVSLSPE
GRKMIEYVNKILKDVEELEQVFLDTEIPSGILKIGTVETVRILPTIIASYYKKYPNVDLS
LQAGLTEELIKKVMNHELDGAFISGPLKHSILEQYDVYTEKLTLVTSNKTFNIEDFSTTP
ILVFNQGCGYRSRLEQWLKDEGVLPNRMMEFNILETILNSVALGLGITVVPESAVMHLAV
QGKVYCHPLPEKDSCISTIFIRHKDAYLTNSMRSLLKTIVEHKNMSMA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcgagacttacaaattttcaaatgcgtagcccatcacaagagtattaccggt
gctgcaaaagagttaaattatgtacaatctaatgtaactgcgcggattaagcaattagag
aatgagctcaaaacacctcttttcaatcgccataaaaaaggggtttcactaagcccagag
ggccgaaaaatgattgaatacgttaacaaaattttgaaagatgttgaagaactggagcaa
gtctttctagatactgaaataccgtctggaatattaaaaatcggtacagtggaaacagtg
aggatactgccgaccatcatagcttcctattataaaaagtatcctaatgtggatttatca
ttgcaggctggtctaacagaggaacttattaaaaaggtcatgaatcacgaattagacgga
gcttttatttcaggccccttgaaacattctattctggaacagtatgatgtttatactgaa
aaacttactcttgtaaccagtaacaaaacgtttaatatagaggatttttcaacgactccg
attcttgtttttaaccaggggtgcgggtatcggtctaggcttgaacaatggctcaaagat
gaaggtgtgctcccaaacagaatgatggaatttaacatcctagagacaatcttaaatagt
gttgcacttggactcggtataacagtggtaccggaatctgctgttatgcatctagctgta
caaggtaaggtttattgccacccattgcctgagaaagacagctgtatctcaacaattttt
atacgccataaagatgcgtacctgacaaattcaatgcgcagcctcctaaagaccattgtt
gaacataaaaatatgagtatggcttaa

DBGET integrated database retrieval system