KEGG   Bacillus subtilis subsp. subtilis 168: BSU26640
Entry
BSU26640          CDS       T00010                                 

Symbol
yrdP
Name
(RefSeq) oxidoreductase
  KO
K07222  putative flavoprotein involved in K+ transport
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSU26640 (yrdP)
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 FMO-like Lys_Orn_oxgnase HI0933_like DAO GIDA NAD_binding_8 Thi4 FAD_binding_2 TrkA_N Pyr_redox
Other DBs
NCBI-GeneID: 937340
NCBI-ProteinID: NP_390541
Pasteur: BG11980
BSORF: BG11980
UniProt: O07085 A0A6M4JM52
Position
complement(2722767..2723804)
AA seq 345 aa
MYDTIVIGAGQAGISIGYYLKQSDQKFIILDKSHEVGESWKDRYDSLVLFTSRMYSSLPG
MHLEGEKHGFPSKNEIVAYLKKYVKKFEIPIQLRTEVISVLKIKNYFLIKTNREEYQTKN
LVIATGPFHTPNIPSISKDLSDNINQLHSSQYKNSKQLAYGNVLVVGGGNSGAQIAVELS
KERVTYLACSNKLVYFPLMIGKRSIFWWFDKLGVLHASHTSIVGKFIQKKGDPVFGHELK
HAIKQKEIILKKRVIAAKQNEIIFKDSSTLEVNNIIWATGFRNPLCWINIKGVLDQEGRI
IHHRGVSPVEGLYFIGLPWQHKRGSALLQGVGNDAEYIVKQMNGE
NT seq 1038 nt   +upstreamnt  +downstreamnt
gtgtacgacactatagtaatcggggctggtcaagcagggatctcaataggatattatctt
aagcagtccgatcaaaagtttatcattttggataaaagtcatgaggtgggggagagctgg
aaagatcggtatgactcattagttttatttacttctcgaatgtatagctctttgcctgga
atgcatcttgaaggagaaaaacatggatttccttcaaaaaatgaaattgttgcttatcta
aagaagtatgttaaaaaatttgaaattccaatccaattacggacagaagtaataagtgtc
ctaaaaataaagaattatttcttaataaaaacaaatcgggaagaatatcaaacgaagaat
cttgtcattgctacagggccttttcatacccctaatattccatcaatatcaaaggattta
tccgataatattaatcaactacactcatcacaatataagaattcaaaacaattggcatat
ggaaatgtactagtagttggtggtgggaatagtggtgctcaaatagctgttgaattatcc
aaagaaagagttacatatttagcttgtagtaataaacttgtttatttccctttaatgatc
ggaaaaagaagcatcttttggtggtttgataaactaggagttttacatgcaagtcataca
tcaatagtaggcaaattcattcaaaagaaaggtgatccagtatttgggcatgaattaaaa
catgcaataaaacagaaggagatcatcttaaaaaaaagagtcattgccgcaaagcaaaat
gaaatcatttttaaagattcatctacattagaagtaaacaatattatttgggctactggt
ttcaggaatcccttatgttggataaatataaaaggtgttttggatcaagaaggtcgaatc
atacatcatagaggtgtttcacctgtagaaggattgtactttataggtttgccttggcag
cataagcgaggttcagcgttgcttcaaggcgtaggaaatgatgctgaatacattgtaaaa
caaatgaacggtgaataa

DBGET integrated database retrieval system