KEGG   Bacillus subtilis subsp. subtilis 168: BSU26650Help
Entry
BSU26650          CDS       T00010                                 

Gene name
czcD
Definition
(RefSeq) cadmium, cobalt and zinc/H
  KO
K16264  cobalt-zinc-cadmium efflux system protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU26650 (czcD)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU26650 (czcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer GpcrRhopsn4 FtsK_4TM DUF2633 PhoLip_ATPase_C Cytochrom_C_asm
Motif
Other DBs
NCBI-GeneID: 937630
NCBI-ProteinID: NP_390542
Pasteur: BG11931
BSORF: BG11931
UniProt: O07084
Position
complement(2723892..2724827)
Genome map
AA seq 311 aa AA seqDB search
MGHNHNEGANKKVLLISFIMITGYMIIEAIGGFLTNSLALLSDAGHMLSDSISLMVALIA
FTLAEKKANHNKTFGYKRFEILAAVINGAALILISLYIIYEAIERFSNPPKVATTGMLTI
SIIGLVVNLLVAWIMMSGGDTKNNLNIRGAYLHVISDMLGSVGAILAAILIIFFGWGWAD
PLASIIVAILVLRSGYNVTKDSIHILMEGTPENIDVSDIIRTIEGTEGIQNIHDLHIWSI
TSGLNALSCHAVVDDQLTISESENILRKIEHELEHKGITHVTIQMETEAHNHDNAILCQP
KMEKQRDHHHH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacaatcataatgaaggagcaaataaaaaggttttattgatctcttttatcatg
attacaggttatatgattatagaagctataggtggatttttaacaaatagcctggcgctt
ttatctgatgcaggccatatgctgagtgattcaatttcattaatggttgccctgattgct
tttacattagctgaaaaaaaggcaaatcacaataagacattcggctataaacgatttgag
attcttgcagctgtgataaacggtgctgccttaattcttatttctctttatatcatttat
gaagcaatcgaacgcttctctaatccaccaaaagtagcaacaaccggcatgcttacaatt
agtatcatcgggttagttgtgaatctattggtcgcttggattatgatgagtggcggagat
acaaagaataatctgaatataagaggagcttatttacatgtaataagcgatatgctcggc
tctgtaggtgccattttagctgccatacttatcatcttctttggatggggctgggcagat
ccattggctagtatcattgtggctattcttgttctaagaagcggttacaatgtgactaaa
gattccattcacatcttaatggaaggaactccagaaaatatcgatgtctctgatatcatt
cgtacaattgaagggacagagggaattcaaaacattcatgatttacacatatggtctatc
acaagcggattgaatgctctttcttgccacgcagttgttgacgatcaactgaccatttca
gaaagtgaaaatattttacgcaaaattgaacatgaacttgagcataaaggcattacgcac
gtaaccattcaaatggaaaccgaagcgcataaccacgacaatgcgatcctttgtcagccc
aaaatggagaagcagcgtgaccaccatcaccattaa

DBGET integrated database retrieval system