KEGG   Bacillus subtilis subsp. subtilis 168: BSU26660
Entry
BSU26660          CDS       T00010                                 

Symbol
yrdN
Name
(RefSeq) tautomerase YrdN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Tautomerase_2 Tautomerase
Other DBs
NCBI-GeneID: 937627
NCBI-ProteinID: NP_390543
Pasteur: BG12287
BSORF: BG12287
UniProt: P94502 A0A6M3ZEL4
Position
complement(2725114..2725503)
AA seq 129 aa
MPLLRFDLIEGRDQSSLKKLLDVAHNVVVEAFDVPQQDRYQIVHEHPENHMIIEDTGLGF
NRTKNLVVLSVTSKSRPEEKKQKFYRLLAERLESECGIASTDLIVSIVENDNADWSFGLG
EAQFLTGKL
NT seq 390 nt   +upstreamnt  +downstreamnt
atgccattacttcgttttgacttaatagaagggcgagatcaatcaagtttgaaaaaactt
ttagatgtcgctcacaatgttgtagtagaggcttttgatgtgcctcaacaagaccgttat
caaattgttcatgaacatccagaaaatcatatgattattgaggatactgggttaggattt
aaccgaactaaaaatcttgttgttctttcagttacaagtaaatcccgaccggaagagaag
aaacaaaaattttacaggctgttagctgaaagactggaatctgagtgtggtatcgcatca
actgatttaattgtatctattgttgaaaatgataatgctgactggagttttggacttggt
gaggcccaatttttaacaggtaaattgtag

DBGET integrated database retrieval system