KEGG   Bacillus subtilis subsp. subtilis 168: BSU26660Help
Entry
BSU26660          CDS       T00010                                 

Gene name
yrdN
Definition
(RefSeq) tautomerase YrdN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase_2 Tautomerase
Motif
Other DBs
NCBI-GeneID: 937627
NCBI-ProteinID: NP_390543
Pasteur: BG12287
BSORF: BG12287
UniProt: P94502
Position
complement(2725114..2725503)
Genome map
AA seq 129 aa AA seqDB search
MPLLRFDLIEGRDQSSLKKLLDVAHNVVVEAFDVPQQDRYQIVHEHPENHMIIEDTGLGF
NRTKNLVVLSVTSKSRPEEKKQKFYRLLAERLESECGIASTDLIVSIVENDNADWSFGLG
EAQFLTGKL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgccattacttcgttttgacttaatagaagggcgagatcaatcaagtttgaaaaaactt
ttagatgtcgctcacaatgttgtagtagaggcttttgatgtgcctcaacaagaccgttat
caaattgttcatgaacatccagaaaatcatatgattattgaggatactgggttaggattt
aaccgaactaaaaatcttgttgttctttcagttacaagtaaatcccgaccggaagagaag
aaacaaaaattttacaggctgttagctgaaagactggaatctgagtgtggtatcgcatca
actgatttaattgtatctattgttgaaaatgataatgctgactggagttttggacttggt
gaggcccaatttttaacaggtaaattgtag

DBGET integrated database retrieval system