KEGG   Bacillus subtilis subsp. subtilis 168: BSU26680
Entry
BSU26680          CDS       T00010                                 

Symbol
yrdK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938740
NCBI-ProteinID: NP_390545
Pasteur: BG12286
BSORF: BG12286
UniProt: P94500 A0A6M3ZE82
Position
complement(2726885..2727163)
AA seq 92 aa
MINQQQYHSDLQDLLHQWILQLLQLDVLPLSNRKYQSSRCHPKSVGEYLIVVRAIDALGN
SQPLTSRRNQVSRAMTFVQNSLNEENLHPNID
NT seq 279 nt   +upstreamnt  +downstreamnt
ttgatcaatcaacagcaatatcactcagatctgcaggatctcctccatcagtggatactt
caactgttacaattggatgttctgcccctgtccaaccgaaaatatcaatcttcccgttgt
cacccgaaatctgtaggtgaatatttaatagttgtgagagcgattgacgctttaggaaat
agtcagcctttaacttcaagacgcaaccaagtgtctagggcaatgaccttcgttcaaaat
tctttgaatgaggaaaatctacatcctaatatcgactag

DBGET integrated database retrieval system