KEGG   Bacillus subtilis subsp. subtilis 168: BSU26700
Entry
BSU26700          CDS       T00010                                 

Symbol
azlD
Name
(RefSeq) branched-chain amino acid transport protein AzlD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AzlD
Other DBs
NCBI-GeneID: 937624
NCBI-ProteinID: NP_390547
Pasteur: BG11916
BSORF: BG11916
UniProt: O07923 A0A6M3ZEF4
Position
complement(2728647..2728979)
AA seq 110 aa
MTMTMTQQMITIAMVVLGTMLTRFLPFMIFPSGKPTPKYVQYLGKVLPSAVIGLLVIYCL
KDVSLLSGSHGIPELVGAAAVVLLHLWKKNMLLSIAGGTVVYMVLVQLVF
NT seq 333 nt   +upstreamnt  +downstreamnt
atgacgatgactatgacgcagcaaatgatcaccatcgcaatggtcgtgcttggaacaatg
ctgacacggttccttccattcatgattttcccgtctggcaaaccgacaccgaaatatgta
cagtatcttggtaaagtgctgccatcagcggtaatcgggcttttagtcatttattgtttg
aaagatgtgagtctactttctggaagtcatggcattcctgaattggttggagcagctgct
gttgtactgcttcacttgtggaagaaaaatatgcttctttccatagcggggggaaccgtt
gtttatatggttttggtgcaattggttttttaa

DBGET integrated database retrieval system