KEGG   Bacillus subtilis subsp. subtilis 168: BSU26710
Entry
BSU26710          CDS       T00010                                 

Symbol
azlC
Name
(RefSeq) branched-chain amino acid transport protein AzlC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AzlC
Other DBs
NCBI-GeneID: 936606
NCBI-ProteinID: NP_390548
Pasteur: BG11915
BSORF: BG11915
UniProt: O07942 A0A6M3ZHM5
Position
complement(2728976..2729740)
AA seq 254 aa
MNKNKESLHLSSPAINTHMNKRSQIWAAFRSAFPYTIPIFAGFLFLGIAYGIFMHSLGFS
AIYPIIMSFMIFAGSMEFVAANFLLGAFNPMNALFLTLMVNARHLFYGISMLDKYRGTGK
KKLYLIFGMCDESFSINYTANVPANVDKGWFMFFVTLLNHLYWVAGAAIGGIFGSYVKFN
TEGLDFVMTALFIVIFIEQWMKEKKHYSALTGLGLSVASLILFGGNQFIIPAMLAILGVL
TVLRKPLEKAEVSV
NT seq 765 nt   +upstreamnt  +downstreamnt
ttgaataaaaataaagaatcgttacatttaagctctcctgctataaacactcatatgaat
aagagaagtcaaatatgggctgcatttcgttctgcattcccatataccattccgattttt
gcggggtttttatttttggggatagcttatgggatctttatgcattctttgggatttagc
gcaatctatccaatcatcatgagttttatgatatttgcgggctcaatggagtttgttgca
gcgaattttttacttggtgcgttcaaccctatgaatgctctttttttgacgttaatggtc
aatgcccggcatttgttttatggaatttccatgttggataagtacagggggactggaaag
aaaaagctttatctgattttcggaatgtgcgatgaatcattttctatcaattataccgct
aatgttccggcgaatgttgataagggctggtttatgttttttgtgacactgcttaatcat
ttatattgggtcgcgggggcagcgataggaggtatttttgggtcgtacgtgaagtttaat
accgaagggcttgattttgtgatgactgctctgtttattgtgatattcatagaacaatgg
atgaaagagaaaaagcattacagtgctctcacgggacttggactttcagtagccagtctt
atcctttttggcggaaaccaatttattattcctgctatgctcgccattttaggggtactg
actgttctgagaaaaccattggagaaagctgaggtttccgtatga

DBGET integrated database retrieval system