KEGG   Bacillus subtilis subsp. subtilis 168: BSU26730
Entry
BSU26730          CDS       T00010                                 

Gene name
yrdF
Definition
(RefSeq) ribonuclease inhibitor YrdF
  KO
K03623  ribonuclease inhibitor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU26730 (yrdF)
SSDB
Motif
Pfam: Barstar
Other DBs
NCBI-GeneID: 936691
NCBI-ProteinID: NP_390550
Pasteur: BG12285
BSORF: BG12285
UniProt: O07938 A0A6M4JLH8
Position
complement(2730560..2730835)
AA seq 91 aa
MRKIIIDGRDFENIEVLHDDLKDKLDFPDYYGRNLDALWDCLTGWVDLPLTLVLKNFEFS
NTFLGSYADDVLEVIQEAQEELKDEFKIIIE
NT seq 276 nt   +upstreamnt  +downstreamnt
atgagaaaaataataatagatggaagagactttgaaaatatagaagttttacatgatgat
ttaaaagataaactagacttcccagactactatgggagaaatttagacgctttatgggat
tgcctgacagggtgggtggatttgccgctcactttagtcttgaaaaattttgagttcagc
aatacatttttaggttcatacgctgacgatgtattagaagttatacaagaggctcaagaa
gaactaaaggacgaatttaaaataataatagagtag

DBGET integrated database retrieval system