KEGG   Bacillus subtilis subsp. subtilis 168: BSU26740Help
Entry
BSU26740          CDS       T00010                                 

Gene name
cypA
Definition
(RefSeq) cytochrome P450
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 937623
NCBI-ProteinID: NP_390551
Pasteur: BG11929
BSORF: BG11929
UniProt: O08469
Position
complement(2731107..2732339)
Genome map
AA seq 410 aa AA seqDB search
MSSKEKKSVTILTESQLSSRAFKDEAYEFYKELRKSQALYPLSLGALGKGWLISRYDDAI
HLLKNEKLKKNYENVFTAKEKRPALLKNEETLTKHMLNSDPPDHNRLRTLVQKAFTHRMI
LQLEDKIQHIADSLLDKVQPNKFMNLVDDYAFPLPIIVISEMLGIPLEDRQKFRVWSQAI
IDFSDAPERLQENDHLLGEFVEYLESLVRKKRREPAGDLISALIQAESEGTQLSTEELYS
MIMLLIVAGHETTVNLITNMTYALMCHHDQLEKLRQQPDLMNSAIEEALRFHSPVELTTI
RWTAEPFILHGQEIKRKDVIIISLASANRDEKIFPNADIFDIERKNNRHIAFGHGNHFCL
GAQLARLEAKIAISTLLRRCPNIQLKGEKKQMKWKGNFLMRALEELPISF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaaagaaaaaaagagtgtaaccattttgacggaaagtcaattgtcttcgaga
gcatttaaagatgaagcgtatgaattttataaagaattgcgaaaatcacaggctctctac
ccattatctttaggagctctggggaaaggctggctcatatcgagatatgatgatgcaata
catttattaaagaatgaaaaattaaagaaaaactatgaaaatgtatttaccgcaaaagaa
aaacgtcctgctctattgaagaatgaagagactttaacaaaacatatgcttaattcagat
ccccctgatcacaaccgcttgcgaactcttgttcaaaaagcatttacgcatcggatgatt
ttgcagttggaagacaaaatccagcatatcgcagattctttattggataaagtgcagccc
aacaaattcatgaacctagtagacgattatgcgtttccattgccgattatcgtgataagt
gaaatgctcggcattcccttggaagatcgtcaaaaattcagagtatggtcgcaagcaatt
attgatttttcagatgcccctgaaagacttcaggagaatgaccacttgttaggggagttt
gttgaatatctggaatccttagttcgcaaaaaaaggagagaacctgcaggagatttaatc
agtgcattaattcaagcggaaagtgaaggcacacaattaagtacagaagaattgtactcg
atgattatgctgcttatcgttgcaggtcatgaaacaaccgtaaacttaatcaccaatatg
acatatgctctgatgtgtcaccatgatcaactagaaaagctccgccagcagccggacttg
atgaattcagccatagaagaagcattgcggtttcacagccctgttgagctaacgacaatt
cgctggacggctgaaccgtttatactgcatgggcaggagattaaacggaaagatgtgatc
atcatttctttagcatcagcaaaccgtgatgaaaagatatttccaaatgccgacatattt
gatattgaaagaaagaacaaccgccatattgcttttggccatggcaatcatttttgtctt
ggtgcacagctagcccgcttagaagcaaagattgcgatttccaccttattacgccgctgt
ccaaatatacagttaaaaggcgaaaagaaacaaatgaaatggaaagggaattttctgatg
agagcactcgaagaactgccgattagtttttaa

DBGET integrated database retrieval system