KEGG   Bacillus subtilis subsp. subtilis 168: BSU26760Help
Entry
BSU26760          CDS       T00010                                 

Gene name
yrdC
Definition
(RefSeq) isochorismatase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase DUF3878 AAA_25
Motif
Other DBs
NCBI-GeneID: 937618
NCBI-ProteinID: NP_390553
Pasteur: BG12283
BSORF: BG12283
UniProt: O07081
Position
complement(2732980..2733543)
Genome map
AA seq 187 aa AA seqDB search
MEEKKALIIVDVQKAFDDKKWGERNNVKAEENISKILELWREKGWTVIYIQHTSDKPHSL
FHPKNEGFAIKEIVKPMDEEVIITKTVNSSFIGTNLEEFLKLNEITTVVITGLTTPHCVS
TTTRMSGNLGFDTYLISDATAAFGMRDQNDTYYDAATIHNISLATLHDEFATILTTDQLI
NDFIKTH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaaaagaaagctttaatcattgtggatgtacaaaaagccttcgatgataaaaaa
tggggggaacggaataacgtaaaggcggaagaaaacattagtaaaatactagaattatgg
agagaaaaaggatggacagtcatatacatacaacacacttctgataaacctcattcttta
ttccatccaaagaatgaagggtttgcaataaaggaaatagttaagcctatggatgaagaa
gtcattataaccaagacagtaaatagcagctttattggtacgaatttagaagaattctta
aaattaaatgaaataaccactgtagtcataactggtttaaccacgcctcactgtgtatca
accaccacaagaatgagtggtaatttagggtttgatacatacctgatttcagatgcaaca
gcagccttcggaatgagagaccaaaatgatacatattatgatgcggcgactattcataat
atatctctagctacattgcatgatgaatttgccacaatattgacaactgatcaattaata
aatgattttataaaaactcactga

DBGET integrated database retrieval system