KEGG   Bacillus subtilis subsp. subtilis 168: BSU26760
Entry
BSU26760          CDS       T00010                                 

Symbol
yrdC
Name
(RefSeq) isochorismatase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Isochorismatase DUF3878
Other DBs
NCBI-GeneID: 937618
NCBI-ProteinID: NP_390553
Pasteur: BG12283
BSORF: BG12283
UniProt: O07081 A0A6M4JLA3
Position
complement(2732980..2733543)
AA seq 187 aa
MEEKKALIIVDVQKAFDDKKWGERNNVKAEENISKILELWREKGWTVIYIQHTSDKPHSL
FHPKNEGFAIKEIVKPMDEEVIITKTVNSSFIGTNLEEFLKLNEITTVVITGLTTPHCVS
TTTRMSGNLGFDTYLISDATAAFGMRDQNDTYYDAATIHNISLATLHDEFATILTTDQLI
NDFIKTH
NT seq 564 nt   +upstreamnt  +downstreamnt
gtggaagaaaagaaagctttaatcattgtggatgtacaaaaagccttcgatgataaaaaa
tggggggaacggaataacgtaaaggcggaagaaaacattagtaaaatactagaattatgg
agagaaaaaggatggacagtcatatacatacaacacacttctgataaacctcattcttta
ttccatccaaagaatgaagggtttgcaataaaggaaatagttaagcctatggatgaagaa
gtcattataaccaagacagtaaatagcagctttattggtacgaatttagaagaattctta
aaattaaatgaaataaccactgtagtcataactggtttaaccacgcctcactgtgtatca
accaccacaagaatgagtggtaatttagggtttgatacatacctgatttcagatgcaaca
gcagccttcggaatgagagaccaaaatgatacatattatgatgcggcgactattcataat
atatctctagctacattgcatgatgaatttgccacaatattgacaactgatcaattaata
aatgattttataaaaactcactga

DBGET integrated database retrieval system