KEGG   Bacillus subtilis subsp. subtilis 168: BSU26770
Entry
BSU26770          CDS       T00010                                 

Symbol
yrdB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2568
Other DBs
NCBI-GeneID: 936140
NCBI-ProteinID: NP_390554
Pasteur: BG12282
BSORF: BG12282
UniProt: O07080 A0A6M4JMP7
Position
complement(2733772..2734143)
AA seq 123 aa
MEKLNQTNLLLRFTLEIAALISLGVYAWISFNGYFKYVLTLVLPIAVMIVWSVFAVPHDP
SRSGQTVIAVNGVTRLVIELLIFAMAVAALYFSYLKPVSIVFLCLIILHYIISAERIKWL
LNQ
NT seq 372 nt   +upstreamnt  +downstreamnt
ttggaaaaactgaatcagactaatttacttttaagattcacccttgaaattgctgcacta
atctccttaggggtgtatgcttggataagctttaatggttattttaaatatgttttaact
ttggttttacctattgcagttatgattgtctggtctgtatttgcagtacctcatgatcct
agtcgaagcggacaaactgtaatagctgtaaacggagtaacaaggttagttattgaatta
ttgatctttgcaatggctgttgcagcgctttattttagttatttaaaaccagttagtatt
gtctttttatgtcttataatactccactacatcatttcagctgagcgtatcaaatggctt
ctaaatcaatag

DBGET integrated database retrieval system