KEGG   Bacillus subtilis subsp. subtilis 168: BSU26780Help
Entry
BSU26780          CDS       T00010                                 

Gene name
yrdA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB DinB_2 MDMPI_N
Motif
Other DBs
NCBI-GeneID: 937620
NCBI-ProteinID: NP_390555
Pasteur: BG12281
BSORF: BG12281
UniProt: O07079
Position
complement(2734953..2735456)
Genome map
AA seq 167 aa AA seqDB search
MFQTLDHFLKSWEFEADATQKLLNSLTDESLKQEITSQNWTLGRIAWHTVAAIGIITSNT
DLTFQAPAEDYPVPTSAQFIADSYHQASNAFVQALKTQWTDHTLQERINFIGQQMPNGSL
LMFLIQHQNHHRGQMTVLMRQAGLTVPGIYGPAKEEWAKFGLEAPKM
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcaaaccttagaccattttttgaaatcttgggagttcgaagcagatgctacacag
aaactattaaatagtctgactgatgaatcacttaaacaagaaataacttcacaaaattgg
actctaggccgtattgcttggcatactgttgctgccattggcatcattacctcaaacaca
gacttaacgttccaagccccagctgaagattatcctgttccaacttctgctcagtttata
gctgacagctatcatcaagccagtaatgcatttgtacaggcattaaaaacccaatggact
gaccatacacttcaagaacgtatcaactttattggacaacaaatgcctaacggttcactt
ttgatgtttttaattcaacatcaaaaccaccatcggggacaaatgactgttcttatgaga
caagcaggtttaactgttccaggtatttatggtccagcaaaagaagaatgggcaaaattt
ggtttggaagccccgaaaatgtaa

DBGET integrated database retrieval system